Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9XAB3

Protein Details
Accession W9XAB3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
170-191RAIELEKKRKDKIRARKIGQLWBasic
NLS Segment(s)
PositionSequence
176-186KKRKDKIRARK
Subcellular Location(s) nucl 18, cyto_nucl 12, cyto 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
Amino Acid Sequences MENLSLNDPPPSSPQRQPNAVLPGVPSQGPPQLPPQMFTTAAQLLDLTDKKLLLVLRDGRKIFGILRSWDQFANLVLTETRERYFVSIPGSTSTDALSATASKDAPTLSANTSLSTSTLPRNMYCDIPRGTYLVRGENVLLLGEVDLDRDDDPPPGYELGDVEEVFRLHRAIELEKKRKDKIRARKIGQLWGGEIEGSGEVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.56
4 0.58
5 0.58
6 0.58
7 0.53
8 0.46
9 0.39
10 0.35
11 0.32
12 0.29
13 0.22
14 0.18
15 0.22
16 0.21
17 0.21
18 0.23
19 0.3
20 0.3
21 0.31
22 0.32
23 0.3
24 0.31
25 0.29
26 0.28
27 0.21
28 0.21
29 0.19
30 0.15
31 0.12
32 0.16
33 0.16
34 0.13
35 0.12
36 0.12
37 0.12
38 0.14
39 0.15
40 0.11
41 0.17
42 0.24
43 0.28
44 0.34
45 0.34
46 0.33
47 0.33
48 0.32
49 0.27
50 0.24
51 0.23
52 0.2
53 0.24
54 0.25
55 0.26
56 0.25
57 0.24
58 0.19
59 0.16
60 0.15
61 0.1
62 0.09
63 0.08
64 0.1
65 0.1
66 0.11
67 0.11
68 0.1
69 0.1
70 0.12
71 0.13
72 0.13
73 0.14
74 0.14
75 0.14
76 0.15
77 0.16
78 0.15
79 0.14
80 0.12
81 0.09
82 0.08
83 0.08
84 0.06
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.08
95 0.08
96 0.11
97 0.11
98 0.11
99 0.12
100 0.11
101 0.11
102 0.1
103 0.1
104 0.09
105 0.13
106 0.13
107 0.13
108 0.16
109 0.17
110 0.2
111 0.19
112 0.23
113 0.21
114 0.22
115 0.22
116 0.2
117 0.19
118 0.2
119 0.21
120 0.19
121 0.18
122 0.17
123 0.16
124 0.15
125 0.15
126 0.1
127 0.09
128 0.05
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.05
135 0.06
136 0.07
137 0.08
138 0.09
139 0.1
140 0.1
141 0.12
142 0.12
143 0.12
144 0.11
145 0.11
146 0.12
147 0.13
148 0.12
149 0.11
150 0.12
151 0.11
152 0.12
153 0.12
154 0.1
155 0.08
156 0.11
157 0.12
158 0.17
159 0.26
160 0.37
161 0.45
162 0.53
163 0.59
164 0.64
165 0.7
166 0.75
167 0.75
168 0.76
169 0.78
170 0.81
171 0.81
172 0.83
173 0.79
174 0.78
175 0.72
176 0.63
177 0.53
178 0.45
179 0.39
180 0.3
181 0.25
182 0.17
183 0.12