Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3KBU9

Protein Details
Accession J3KBU9    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-138ANGMKKRGPGRPKKGEAKKQQKTPTPRSTDGBasic
NLS Segment(s)
PositionSequence
110-135GMKKRGPGRPKKGEAKKQQKTPTPRS
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
KEGG cim:CIMG_03651  -  
Amino Acid Sequences MSAEAVNGGPVAQPVPDRDAQENKEATPQPEKPIEVNGDAAQPEEKEKATEGEKAIGEKREHDESGTAKEGKATSEGPPEKKQKVETEKQPDGEAKPASPNRENVDAANGMKKRGPGRPKKGEAKKQQKTPTPRSTDGIGSRTRSRTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.16
3 0.19
4 0.22
5 0.26
6 0.34
7 0.35
8 0.41
9 0.4
10 0.36
11 0.41
12 0.4
13 0.38
14 0.39
15 0.39
16 0.37
17 0.39
18 0.4
19 0.33
20 0.35
21 0.35
22 0.28
23 0.28
24 0.23
25 0.21
26 0.19
27 0.19
28 0.14
29 0.12
30 0.12
31 0.12
32 0.11
33 0.1
34 0.11
35 0.13
36 0.14
37 0.18
38 0.17
39 0.19
40 0.19
41 0.2
42 0.22
43 0.24
44 0.23
45 0.22
46 0.24
47 0.24
48 0.24
49 0.22
50 0.22
51 0.18
52 0.22
53 0.23
54 0.19
55 0.16
56 0.17
57 0.17
58 0.15
59 0.15
60 0.13
61 0.11
62 0.19
63 0.22
64 0.24
65 0.3
66 0.35
67 0.35
68 0.36
69 0.38
70 0.38
71 0.44
72 0.47
73 0.5
74 0.54
75 0.56
76 0.54
77 0.53
78 0.47
79 0.4
80 0.38
81 0.29
82 0.21
83 0.25
84 0.27
85 0.3
86 0.3
87 0.33
88 0.31
89 0.35
90 0.35
91 0.28
92 0.29
93 0.26
94 0.24
95 0.28
96 0.24
97 0.21
98 0.22
99 0.25
100 0.26
101 0.32
102 0.42
103 0.45
104 0.55
105 0.64
106 0.72
107 0.79
108 0.85
109 0.87
110 0.88
111 0.89
112 0.87
113 0.87
114 0.87
115 0.86
116 0.85
117 0.85
118 0.84
119 0.81
120 0.76
121 0.7
122 0.64
123 0.62
124 0.58
125 0.53
126 0.47
127 0.44
128 0.47
129 0.51