Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JUV0

Protein Details
Accession A0A0D8JUV0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-120EEEKKEKEISRRRKANFKKVIPNMCGHydrophilic
NLS Segment(s)
PositionSequence
98-111KKEKEISRRRKANF
133-145KRGTKKEKKSKVK
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
KEGG cim:CIMG_13325  -  
Amino Acid Sequences MLASLPAYRPHWRLADWRKLRFPDSGRLLICQPANHARKGGLNPPSVPDLWRTSSLQGMKQVLQFTYVPRPHRVLLPLRENMILHVNHYSVHKQEEEKKEKEISRRRKANFKKVIPNMCGNTSWGILIQYNIKRGTKKEKKSKVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.57
4 0.62
5 0.65
6 0.66
7 0.66
8 0.63
9 0.57
10 0.56
11 0.54
12 0.53
13 0.46
14 0.44
15 0.43
16 0.4
17 0.37
18 0.28
19 0.26
20 0.29
21 0.32
22 0.31
23 0.31
24 0.27
25 0.31
26 0.34
27 0.36
28 0.33
29 0.32
30 0.32
31 0.33
32 0.34
33 0.29
34 0.27
35 0.23
36 0.2
37 0.2
38 0.22
39 0.21
40 0.19
41 0.24
42 0.25
43 0.24
44 0.24
45 0.23
46 0.22
47 0.23
48 0.23
49 0.19
50 0.19
51 0.17
52 0.16
53 0.22
54 0.24
55 0.24
56 0.26
57 0.28
58 0.26
59 0.28
60 0.3
61 0.28
62 0.3
63 0.33
64 0.32
65 0.31
66 0.31
67 0.29
68 0.26
69 0.24
70 0.18
71 0.14
72 0.13
73 0.12
74 0.12
75 0.14
76 0.15
77 0.11
78 0.14
79 0.15
80 0.17
81 0.26
82 0.35
83 0.41
84 0.41
85 0.44
86 0.48
87 0.5
88 0.57
89 0.59
90 0.59
91 0.62
92 0.7
93 0.71
94 0.75
95 0.81
96 0.82
97 0.82
98 0.79
99 0.79
100 0.79
101 0.82
102 0.76
103 0.73
104 0.65
105 0.57
106 0.5
107 0.41
108 0.34
109 0.27
110 0.23
111 0.16
112 0.14
113 0.12
114 0.13
115 0.19
116 0.2
117 0.25
118 0.28
119 0.31
120 0.34
121 0.39
122 0.49
123 0.52
124 0.6
125 0.66