Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XWS7

Protein Details
Accession W9XWS7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
91-116KQLQNLKEERKERDKKKNVRQNESEYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.833, nucl 8.5, cyto_mito 6.999, mito 6.5, cyto 6, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MAEEAEAVHKNLRSALWFKIGQIVDDESIALGVNATPQFIGSLMELVWAHIGNVAVDLEAFAKHGGRRTITTDDVMLLTRRNEGLEQILEKQLQNLKEERKERDKKKNVRQNESEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.26
4 0.25
5 0.25
6 0.31
7 0.3
8 0.26
9 0.25
10 0.24
11 0.18
12 0.18
13 0.17
14 0.09
15 0.09
16 0.08
17 0.06
18 0.04
19 0.03
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.07
28 0.05
29 0.05
30 0.05
31 0.07
32 0.06
33 0.06
34 0.07
35 0.06
36 0.05
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.05
50 0.06
51 0.09
52 0.11
53 0.12
54 0.14
55 0.18
56 0.21
57 0.22
58 0.22
59 0.19
60 0.18
61 0.17
62 0.16
63 0.13
64 0.1
65 0.1
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.13
72 0.14
73 0.15
74 0.17
75 0.19
76 0.19
77 0.19
78 0.22
79 0.23
80 0.22
81 0.24
82 0.28
83 0.33
84 0.4
85 0.46
86 0.5
87 0.57
88 0.66
89 0.72
90 0.77
91 0.81
92 0.83
93 0.88
94 0.9
95 0.9
96 0.9