Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9XEV7

Protein Details
Accession W9XEV7    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-44LKKSSKSKDIKLKIRCRRYLHydrophilic
NLS Segment(s)
PositionSequence
18-35KDATGARLKKSSKSKDIK
73-81KKTKKNKKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSQVTDIKQFLEIARRKDATGARLKKSSKSKDIKLKIRCRRYLYTLILKDSDKADKIKQSLPPTLPFQEISKKTKKNKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.36
4 0.35
5 0.39
6 0.41
7 0.38
8 0.44
9 0.46
10 0.43
11 0.49
12 0.5
13 0.52
14 0.58
15 0.59
16 0.58
17 0.59
18 0.63
19 0.67
20 0.74
21 0.76
22 0.76
23 0.79
24 0.78
25 0.8
26 0.78
27 0.74
28 0.68
29 0.65
30 0.62
31 0.57
32 0.57
33 0.5
34 0.46
35 0.42
36 0.38
37 0.34
38 0.29
39 0.26
40 0.19
41 0.2
42 0.22
43 0.25
44 0.28
45 0.31
46 0.36
47 0.38
48 0.43
49 0.44
50 0.45
51 0.45
52 0.44
53 0.41
54 0.36
55 0.34
56 0.37
57 0.4
58 0.43
59 0.47
60 0.53
61 0.62