Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y704

Protein Details
Accession W9Y704   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-106SPSAKKGKMSPRVKPKPRGKAQAPSHydrophilic
NLS Segment(s)
PositionSequence
62-70GSAKRRRSK
85-102AKKGKMSPRVKPKPRGKA
Subcellular Location(s) nucl 16, cyto_nucl 15.5, cyto 11
Family & Domain DBs
Amino Acid Sequences MSDVKINYAAIAEKMGPECTAKAIIHRIAKIKDTARKLDGGEAGAEAEGGNTPPTTPAKSPGSAKRRRSKATGVDGIDETDSPSAKKGKMSPRVKPKPRGKAQAPSGVKQEAADPEFTSVKKEELEEDSNDGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.14
5 0.14
6 0.14
7 0.17
8 0.15
9 0.17
10 0.22
11 0.27
12 0.3
13 0.33
14 0.36
15 0.35
16 0.37
17 0.39
18 0.4
19 0.42
20 0.42
21 0.44
22 0.4
23 0.4
24 0.39
25 0.37
26 0.32
27 0.25
28 0.21
29 0.16
30 0.14
31 0.11
32 0.1
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.06
41 0.08
42 0.1
43 0.1
44 0.15
45 0.18
46 0.2
47 0.25
48 0.32
49 0.4
50 0.46
51 0.54
52 0.58
53 0.62
54 0.63
55 0.63
56 0.6
57 0.59
58 0.58
59 0.56
60 0.48
61 0.43
62 0.39
63 0.36
64 0.29
65 0.21
66 0.14
67 0.09
68 0.08
69 0.06
70 0.09
71 0.11
72 0.11
73 0.14
74 0.21
75 0.3
76 0.4
77 0.46
78 0.53
79 0.62
80 0.72
81 0.78
82 0.81
83 0.82
84 0.82
85 0.85
86 0.86
87 0.8
88 0.79
89 0.77
90 0.77
91 0.71
92 0.63
93 0.58
94 0.49
95 0.43
96 0.34
97 0.31
98 0.26
99 0.23
100 0.22
101 0.18
102 0.21
103 0.23
104 0.23
105 0.23
106 0.19
107 0.19
108 0.19
109 0.2
110 0.21
111 0.24
112 0.28
113 0.27