Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y650

Protein Details
Accession W9Y650   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-51NVPKTRRTYCKGKTCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDATRFELESFTTSIEDSQEFLVNVPKTRRTYCKGKTCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.11
5 0.12
6 0.13
7 0.12
8 0.12
9 0.19
10 0.18
11 0.22
12 0.25
13 0.3
14 0.32
15 0.37
16 0.43
17 0.43
18 0.52
19 0.57
20 0.64
21 0.68
22 0.74
23 0.8
24 0.82
25 0.86
26 0.86
27 0.87
28 0.87
29 0.87
30 0.86
31 0.86
32 0.87
33 0.79
34 0.78
35 0.71
36 0.65
37 0.57
38 0.5
39 0.4
40 0.31
41 0.3
42 0.29
43 0.28
44 0.25
45 0.3
46 0.34
47 0.38
48 0.42
49 0.46
50 0.43
51 0.49
52 0.56
53 0.54
54 0.56
55 0.55
56 0.55
57 0.54
58 0.57
59 0.49
60 0.45
61 0.41
62 0.34
63 0.37
64 0.39
65 0.38
66 0.33
67 0.4
68 0.44
69 0.53
70 0.62
71 0.64
72 0.64
73 0.67
74 0.74
75 0.74
76 0.73
77 0.7
78 0.65
79 0.62
80 0.6
81 0.55
82 0.5
83 0.48
84 0.41
85 0.36
86 0.33
87 0.32
88 0.37
89 0.43
90 0.46
91 0.49
92 0.58
93 0.65
94 0.71
95 0.68
96 0.63
97 0.59
98 0.55
99 0.54
100 0.54
101 0.54
102 0.55
103 0.58
104 0.54
105 0.51
106 0.49
107 0.42