Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9Y3N5

Protein Details
Accession W9Y3N5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-78KMLRQRKELLIEKRRRRAERBasic
NLS Segment(s)
PositionSequence
70-75EKRRRR
Subcellular Location(s) mito 14.5, cyto_mito 9, nucl 6, cyto 2.5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVHKILFWAGFGIATRFVQLGIEMRPFFQRGALWVYPLFAGIGGSFGYWMQGVEARQLKMLRQRKELLIEKRRRRAERETAASEAETTGVLASTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.09
6 0.09
7 0.1
8 0.11
9 0.15
10 0.14
11 0.15
12 0.17
13 0.18
14 0.17
15 0.16
16 0.14
17 0.12
18 0.19
19 0.18
20 0.18
21 0.17
22 0.17
23 0.15
24 0.15
25 0.13
26 0.06
27 0.06
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.04
35 0.04
36 0.04
37 0.03
38 0.05
39 0.06
40 0.1
41 0.13
42 0.13
43 0.16
44 0.17
45 0.19
46 0.27
47 0.35
48 0.34
49 0.37
50 0.4
51 0.4
52 0.48
53 0.55
54 0.55
55 0.58
56 0.64
57 0.68
58 0.74
59 0.8
60 0.77
61 0.75
62 0.73
63 0.74
64 0.74
65 0.72
66 0.68
67 0.61
68 0.58
69 0.52
70 0.43
71 0.32
72 0.22
73 0.14
74 0.09
75 0.07