Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XZY0

Protein Details
Accession W9XZY0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
136-160KVRDMEEKRKAKRREMKAYVKRLDEBasic
NLS Segment(s)
PositionSequence
143-151KRKAKRREM
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 6, plas 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MSSDILTQLQTCYDQLLTQFFSTISYLSQRHPLVAPDPDPNDPFTYPPSATTATQTPGGDQSQPQGSGPQPGPEDTDRSAYPLRPVPPQTFAKAQRELAEDLVQKGQQIELLISRLPGIGRGEEQQAEEIRVLAEKVRDMEEKRKAKRREMKAYVKRLDEVIMGMSRSIDDSNINGETT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.16
4 0.17
5 0.16
6 0.17
7 0.15
8 0.16
9 0.15
10 0.14
11 0.12
12 0.14
13 0.15
14 0.17
15 0.24
16 0.23
17 0.24
18 0.25
19 0.26
20 0.25
21 0.28
22 0.28
23 0.27
24 0.29
25 0.3
26 0.3
27 0.3
28 0.29
29 0.25
30 0.24
31 0.21
32 0.22
33 0.19
34 0.2
35 0.21
36 0.2
37 0.2
38 0.22
39 0.21
40 0.19
41 0.22
42 0.21
43 0.18
44 0.18
45 0.19
46 0.17
47 0.15
48 0.16
49 0.15
50 0.16
51 0.15
52 0.15
53 0.14
54 0.18
55 0.18
56 0.19
57 0.17
58 0.17
59 0.2
60 0.19
61 0.21
62 0.17
63 0.2
64 0.16
65 0.19
66 0.19
67 0.17
68 0.18
69 0.2
70 0.2
71 0.22
72 0.25
73 0.23
74 0.28
75 0.29
76 0.29
77 0.31
78 0.33
79 0.35
80 0.34
81 0.33
82 0.3
83 0.31
84 0.29
85 0.24
86 0.24
87 0.19
88 0.18
89 0.18
90 0.15
91 0.13
92 0.12
93 0.11
94 0.08
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.09
105 0.09
106 0.09
107 0.1
108 0.12
109 0.14
110 0.14
111 0.14
112 0.15
113 0.15
114 0.15
115 0.13
116 0.12
117 0.1
118 0.1
119 0.1
120 0.09
121 0.09
122 0.09
123 0.11
124 0.14
125 0.18
126 0.21
127 0.3
128 0.38
129 0.46
130 0.54
131 0.62
132 0.64
133 0.71
134 0.77
135 0.79
136 0.8
137 0.81
138 0.84
139 0.84
140 0.88
141 0.84
142 0.77
143 0.68
144 0.58
145 0.49
146 0.39
147 0.3
148 0.23
149 0.19
150 0.16
151 0.15
152 0.14
153 0.12
154 0.13
155 0.12
156 0.1
157 0.09
158 0.1
159 0.14