Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RUZ4

Protein Details
Accession A0A0E1RUZ4   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-29MSQPPSTFRTKQKPERLPITVHydrophilic
196-227SIRNEGRKERMERIRRNERKMRANMRRTGNAKBasic
NLS Segment(s)
PositionSequence
126-133ARKKGIGK
198-230RNEGRKERMERIRRNERKMRANMRRTGNAKSKA
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG cim:CIMG_07546  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSSGQTDAMSQPPSTFRTKQKPERLPITVEKPTPYTFDLGRLMALDPNPLNLPANSLSNPPVLNSTLKSTARDGAQCLLNQLLTACPITSSATDGVLLTLPTPVTPLPRFKPLPTPKPPTKWELFARKKGIGKYNNKLGANEAERRKKLVYDEEKGEWMPRWGYKGKNKAEDDQWLVEVDDKKWKKEEDMNIRGESIRNEGRKERMERIRRNERKMRANMRRTGNAKSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.39
4 0.48
5 0.58
6 0.66
7 0.74
8 0.79
9 0.81
10 0.83
11 0.78
12 0.74
13 0.71
14 0.68
15 0.64
16 0.57
17 0.51
18 0.46
19 0.43
20 0.4
21 0.34
22 0.29
23 0.23
24 0.25
25 0.25
26 0.22
27 0.21
28 0.19
29 0.18
30 0.17
31 0.17
32 0.16
33 0.13
34 0.15
35 0.15
36 0.15
37 0.15
38 0.13
39 0.16
40 0.14
41 0.16
42 0.16
43 0.17
44 0.17
45 0.18
46 0.18
47 0.15
48 0.16
49 0.15
50 0.16
51 0.15
52 0.18
53 0.23
54 0.24
55 0.25
56 0.24
57 0.26
58 0.26
59 0.26
60 0.24
61 0.2
62 0.22
63 0.2
64 0.2
65 0.17
66 0.14
67 0.13
68 0.12
69 0.08
70 0.07
71 0.07
72 0.06
73 0.05
74 0.06
75 0.07
76 0.07
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.09
92 0.11
93 0.15
94 0.17
95 0.24
96 0.25
97 0.26
98 0.36
99 0.4
100 0.47
101 0.5
102 0.56
103 0.55
104 0.6
105 0.61
106 0.56
107 0.51
108 0.47
109 0.47
110 0.5
111 0.51
112 0.52
113 0.53
114 0.52
115 0.54
116 0.52
117 0.53
118 0.51
119 0.52
120 0.51
121 0.55
122 0.57
123 0.54
124 0.5
125 0.44
126 0.41
127 0.37
128 0.39
129 0.37
130 0.39
131 0.39
132 0.41
133 0.4
134 0.36
135 0.35
136 0.38
137 0.39
138 0.36
139 0.4
140 0.39
141 0.4
142 0.38
143 0.36
144 0.27
145 0.21
146 0.18
147 0.15
148 0.19
149 0.21
150 0.28
151 0.36
152 0.44
153 0.49
154 0.56
155 0.58
156 0.58
157 0.58
158 0.57
159 0.53
160 0.45
161 0.39
162 0.3
163 0.27
164 0.27
165 0.25
166 0.2
167 0.26
168 0.26
169 0.28
170 0.32
171 0.33
172 0.34
173 0.4
174 0.49
175 0.5
176 0.57
177 0.59
178 0.55
179 0.55
180 0.5
181 0.43
182 0.34
183 0.3
184 0.29
185 0.28
186 0.31
187 0.35
188 0.41
189 0.48
190 0.52
191 0.55
192 0.58
193 0.65
194 0.71
195 0.76
196 0.81
197 0.82
198 0.86
199 0.86
200 0.84
201 0.84
202 0.85
203 0.86
204 0.85
205 0.86
206 0.84
207 0.83
208 0.83
209 0.76
210 0.75