Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XWQ3

Protein Details
Accession W9XWQ3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
198-225SWKYEPFPPRPRPKVRVRVKVRVKVRVKBasic
261-293RVKVKVRVKVRVKARPKVKPQLRSKDYNRMRTYHydrophilic
NLS Segment(s)
PositionSequence
206-283PRPRPKVRVRVKVRVKVRVKVRVKVRVKVRVKVKVRVKVKVRVKVRVKVRVKVKVRVKVKVRVKVRVKARPKVKPQLR
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MSALARHEEASGFMRLPAETRLHIYSYLIPKDRIEMDLCNPQRPENPDEPHGTSTTPSFYPTSHSTPSYSRRTVITGIVDQALQLEIITRNNGLQLLLVSQRTHDEVWPMLCKVPVRFHCLKCFEEVLRNLSFGLGAGVRWMKHVEIVVNCGAGLFGPPFRPLTDSLAKFMVTEAVQTARHTVWMYCGRLGVLIEQDSWKYEPFPPRPRPKVRVRVKVRVKVRVKVRVKVRVKVRVKVKVRVKVKVRVKVRVKVRVKVKVRVKVKVRVKVRVKARPKVKPQLRSKDYNRMRTYLSQDYISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.19
5 0.19
6 0.18
7 0.22
8 0.23
9 0.24
10 0.24
11 0.25
12 0.28
13 0.32
14 0.38
15 0.37
16 0.36
17 0.34
18 0.38
19 0.38
20 0.33
21 0.28
22 0.25
23 0.26
24 0.35
25 0.36
26 0.37
27 0.36
28 0.36
29 0.4
30 0.42
31 0.45
32 0.43
33 0.47
34 0.46
35 0.5
36 0.51
37 0.48
38 0.44
39 0.37
40 0.29
41 0.25
42 0.24
43 0.19
44 0.17
45 0.16
46 0.15
47 0.2
48 0.24
49 0.28
50 0.28
51 0.29
52 0.3
53 0.35
54 0.42
55 0.44
56 0.41
57 0.37
58 0.35
59 0.37
60 0.36
61 0.33
62 0.29
63 0.23
64 0.22
65 0.21
66 0.19
67 0.16
68 0.15
69 0.11
70 0.07
71 0.06
72 0.06
73 0.07
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.08
81 0.07
82 0.06
83 0.08
84 0.09
85 0.11
86 0.1
87 0.1
88 0.11
89 0.13
90 0.13
91 0.12
92 0.12
93 0.12
94 0.15
95 0.16
96 0.16
97 0.15
98 0.15
99 0.16
100 0.17
101 0.24
102 0.24
103 0.31
104 0.37
105 0.39
106 0.45
107 0.48
108 0.46
109 0.41
110 0.4
111 0.33
112 0.32
113 0.32
114 0.28
115 0.24
116 0.23
117 0.2
118 0.18
119 0.16
120 0.1
121 0.09
122 0.05
123 0.04
124 0.05
125 0.06
126 0.06
127 0.07
128 0.08
129 0.07
130 0.08
131 0.09
132 0.1
133 0.09
134 0.12
135 0.11
136 0.11
137 0.1
138 0.09
139 0.09
140 0.06
141 0.06
142 0.04
143 0.04
144 0.05
145 0.06
146 0.07
147 0.07
148 0.09
149 0.1
150 0.16
151 0.22
152 0.22
153 0.23
154 0.23
155 0.23
156 0.21
157 0.19
158 0.16
159 0.09
160 0.08
161 0.07
162 0.09
163 0.09
164 0.09
165 0.11
166 0.09
167 0.1
168 0.11
169 0.1
170 0.15
171 0.2
172 0.21
173 0.2
174 0.2
175 0.19
176 0.19
177 0.19
178 0.14
179 0.1
180 0.09
181 0.09
182 0.09
183 0.1
184 0.11
185 0.11
186 0.11
187 0.11
188 0.15
189 0.24
190 0.32
191 0.42
192 0.5
193 0.59
194 0.69
195 0.75
196 0.78
197 0.8
198 0.82
199 0.82
200 0.83
201 0.81
202 0.82
203 0.83
204 0.84
205 0.81
206 0.8
207 0.75
208 0.72
209 0.72
210 0.72
211 0.68
212 0.66
213 0.68
214 0.68
215 0.68
216 0.68
217 0.68
218 0.68
219 0.68
220 0.69
221 0.69
222 0.69
223 0.69
224 0.71
225 0.72
226 0.71
227 0.71
228 0.73
229 0.7
230 0.7
231 0.73
232 0.73
233 0.7
234 0.71
235 0.73
236 0.72
237 0.74
238 0.75
239 0.71
240 0.69
241 0.72
242 0.72
243 0.7
244 0.71
245 0.72
246 0.71
247 0.71
248 0.73
249 0.7
250 0.7
251 0.73
252 0.73
253 0.7
254 0.71
255 0.73
256 0.73
257 0.76
258 0.77
259 0.77
260 0.77
261 0.81
262 0.81
263 0.83
264 0.86
265 0.85
266 0.85
267 0.86
268 0.88
269 0.85
270 0.85
271 0.82
272 0.82
273 0.83
274 0.83
275 0.77
276 0.69
277 0.67
278 0.64
279 0.64
280 0.62
281 0.55