Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y317

Protein Details
Accession W9Y317    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-57GASGSSKKSEERRKPKKLGQKAQSNGHydrophilic
NLS Segment(s)
PositionSequence
38-50KKSEERRKPKKLG
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSAEQETKSTEETSIGGNLDAAGSASGAANIGASGSSKKSEERRKPKKLGQKAQSNGTPQKEDAEGEQDEPSSPTPQPQKMEQQSRSKSRQASRGRGRQSSLPPSDTDSAYRSDVSQKGARRTRNRNRGKAQAQAQTQQQGGGGGPLDAVDEVGETVNGVVDGASGALDNTVGNVGKAVGKPHEALGGLLHSKGGNEEGGEKDEGGTDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.12
5 0.11
6 0.1
7 0.09
8 0.07
9 0.05
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.06
22 0.08
23 0.1
24 0.11
25 0.17
26 0.26
27 0.37
28 0.47
29 0.57
30 0.67
31 0.75
32 0.83
33 0.87
34 0.88
35 0.89
36 0.88
37 0.86
38 0.86
39 0.8
40 0.78
41 0.74
42 0.7
43 0.65
44 0.59
45 0.52
46 0.41
47 0.39
48 0.33
49 0.29
50 0.23
51 0.22
52 0.18
53 0.17
54 0.18
55 0.15
56 0.15
57 0.15
58 0.15
59 0.13
60 0.12
61 0.16
62 0.22
63 0.26
64 0.28
65 0.31
66 0.4
67 0.46
68 0.55
69 0.56
70 0.6
71 0.63
72 0.68
73 0.69
74 0.65
75 0.63
76 0.59
77 0.61
78 0.6
79 0.63
80 0.65
81 0.68
82 0.68
83 0.64
84 0.61
85 0.58
86 0.55
87 0.53
88 0.46
89 0.39
90 0.34
91 0.35
92 0.35
93 0.29
94 0.25
95 0.18
96 0.17
97 0.16
98 0.16
99 0.13
100 0.15
101 0.16
102 0.18
103 0.21
104 0.22
105 0.3
106 0.35
107 0.42
108 0.46
109 0.56
110 0.62
111 0.69
112 0.75
113 0.76
114 0.76
115 0.78
116 0.73
117 0.69
118 0.65
119 0.62
120 0.55
121 0.49
122 0.45
123 0.38
124 0.35
125 0.28
126 0.21
127 0.15
128 0.12
129 0.1
130 0.08
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.02
148 0.02
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.08
164 0.09
165 0.11
166 0.12
167 0.14
168 0.15
169 0.16
170 0.17
171 0.15
172 0.14
173 0.13
174 0.15
175 0.13
176 0.12
177 0.12
178 0.1
179 0.1
180 0.1
181 0.11
182 0.08
183 0.08
184 0.11
185 0.12
186 0.15
187 0.15
188 0.15
189 0.14
190 0.15
191 0.15
192 0.14
193 0.14
194 0.12
195 0.16
196 0.17
197 0.2
198 0.19
199 0.19
200 0.19
201 0.19
202 0.2
203 0.2
204 0.21
205 0.19
206 0.19
207 0.18
208 0.19
209 0.17
210 0.16
211 0.14
212 0.13
213 0.13
214 0.15
215 0.16
216 0.15
217 0.17
218 0.18
219 0.17