Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y4J1

Protein Details
Accession W9Y4J1    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
139-164SLPPPPPPAKIRRKRRGSKVIFRSTSHydrophilic
NLS Segment(s)
PositionSequence
111-115KHRRR
144-157PPPAKIRRKRRGSK
Subcellular Location(s) nucl 17, cyto 6, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MGCFCSRFAAAADEEQPSSIPRLVPLSSPVADVEPTPGPEPAPAPAPAPAPAPAPAPAPAPAPAPAPPPPPAAAAATAPSPPETDLSWRGWQHLLCDEELAVAAAPAPPAKHRRRGLIKAIRTSSSWTTVKCRTETEDSLPPPPPPAKIRRKRRGSKVIFRSTSTDTSGSVYSQACSTKSRSTILYPEWEREPELDLELVPGPAMPAIRILAATDSEVAAEGPLREPVLWPQCHRRLRSSLWKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.17
5 0.18
6 0.17
7 0.15
8 0.14
9 0.18
10 0.19
11 0.2
12 0.22
13 0.23
14 0.22
15 0.22
16 0.21
17 0.19
18 0.18
19 0.17
20 0.17
21 0.14
22 0.16
23 0.16
24 0.16
25 0.15
26 0.16
27 0.17
28 0.14
29 0.15
30 0.14
31 0.14
32 0.16
33 0.17
34 0.17
35 0.17
36 0.17
37 0.15
38 0.16
39 0.16
40 0.15
41 0.16
42 0.16
43 0.16
44 0.16
45 0.16
46 0.16
47 0.16
48 0.16
49 0.16
50 0.16
51 0.18
52 0.19
53 0.21
54 0.22
55 0.23
56 0.22
57 0.22
58 0.22
59 0.19
60 0.18
61 0.15
62 0.14
63 0.12
64 0.11
65 0.1
66 0.1
67 0.09
68 0.08
69 0.09
70 0.09
71 0.12
72 0.15
73 0.19
74 0.23
75 0.23
76 0.24
77 0.26
78 0.25
79 0.23
80 0.25
81 0.22
82 0.17
83 0.17
84 0.15
85 0.13
86 0.12
87 0.1
88 0.05
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.08
96 0.16
97 0.2
98 0.29
99 0.31
100 0.4
101 0.47
102 0.53
103 0.6
104 0.61
105 0.62
106 0.59
107 0.58
108 0.51
109 0.44
110 0.41
111 0.32
112 0.29
113 0.25
114 0.2
115 0.23
116 0.28
117 0.3
118 0.28
119 0.28
120 0.26
121 0.3
122 0.31
123 0.31
124 0.33
125 0.31
126 0.33
127 0.33
128 0.29
129 0.27
130 0.25
131 0.24
132 0.22
133 0.31
134 0.39
135 0.48
136 0.59
137 0.66
138 0.76
139 0.82
140 0.87
141 0.88
142 0.87
143 0.87
144 0.86
145 0.86
146 0.77
147 0.7
148 0.64
149 0.57
150 0.5
151 0.42
152 0.32
153 0.23
154 0.22
155 0.21
156 0.17
157 0.15
158 0.13
159 0.11
160 0.13
161 0.13
162 0.13
163 0.15
164 0.18
165 0.2
166 0.22
167 0.24
168 0.24
169 0.26
170 0.3
171 0.31
172 0.36
173 0.33
174 0.34
175 0.35
176 0.34
177 0.31
178 0.27
179 0.27
180 0.19
181 0.19
182 0.16
183 0.13
184 0.14
185 0.13
186 0.12
187 0.09
188 0.08
189 0.06
190 0.07
191 0.07
192 0.06
193 0.06
194 0.07
195 0.07
196 0.08
197 0.08
198 0.08
199 0.09
200 0.09
201 0.09
202 0.08
203 0.08
204 0.08
205 0.08
206 0.07
207 0.07
208 0.07
209 0.08
210 0.09
211 0.1
212 0.1
213 0.11
214 0.19
215 0.27
216 0.31
217 0.35
218 0.44
219 0.53
220 0.61
221 0.64
222 0.63
223 0.61
224 0.66