Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XVQ1

Protein Details
Accession W9XVQ1   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
146-170DEDPGLPRRSKRKWEKELDIKIQDLHydrophilic
NLS Segment(s)
PositionSequence
85-94ERIRRHKRLI
156-157KR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPLDPSNQLKIGRHTISLIYQLLTTAELAVPNPENSDNPEFKVLSEVSGELYLEMEPLMEKVANSDLLCDEHIRALEQGERLVKERIRRHKRLIILKKMKLAANLASELLDNPPGLDLKDLYDENKAIDDHGNNNDDAETVNQDLDEDPGLPRRSKRKWEKELDIKIQDLEHLRKRLREFKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.32
4 0.33
5 0.28
6 0.2
7 0.18
8 0.17
9 0.15
10 0.14
11 0.11
12 0.08
13 0.07
14 0.07
15 0.07
16 0.1
17 0.11
18 0.11
19 0.13
20 0.13
21 0.14
22 0.19
23 0.25
24 0.24
25 0.24
26 0.27
27 0.25
28 0.24
29 0.28
30 0.22
31 0.17
32 0.16
33 0.14
34 0.12
35 0.12
36 0.12
37 0.07
38 0.08
39 0.07
40 0.06
41 0.05
42 0.04
43 0.04
44 0.04
45 0.05
46 0.04
47 0.04
48 0.06
49 0.07
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.11
56 0.1
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.08
63 0.1
64 0.1
65 0.11
66 0.12
67 0.12
68 0.14
69 0.17
70 0.18
71 0.23
72 0.3
73 0.4
74 0.47
75 0.52
76 0.56
77 0.59
78 0.65
79 0.68
80 0.69
81 0.69
82 0.69
83 0.66
84 0.64
85 0.61
86 0.54
87 0.45
88 0.38
89 0.29
90 0.22
91 0.2
92 0.16
93 0.13
94 0.12
95 0.11
96 0.1
97 0.08
98 0.06
99 0.05
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.1
107 0.1
108 0.11
109 0.13
110 0.13
111 0.13
112 0.14
113 0.13
114 0.11
115 0.13
116 0.14
117 0.15
118 0.19
119 0.2
120 0.19
121 0.19
122 0.18
123 0.15
124 0.15
125 0.12
126 0.1
127 0.09
128 0.09
129 0.09
130 0.09
131 0.09
132 0.1
133 0.09
134 0.08
135 0.08
136 0.15
137 0.18
138 0.2
139 0.26
140 0.34
141 0.42
142 0.52
143 0.63
144 0.67
145 0.75
146 0.82
147 0.87
148 0.88
149 0.9
150 0.88
151 0.81
152 0.71
153 0.62
154 0.52
155 0.45
156 0.41
157 0.39
158 0.38
159 0.42
160 0.44
161 0.49
162 0.56