Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y381

Protein Details
Accession W9Y381    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-35PFSLLPKVLSVRRKRKKLRVQFVSDLHLHydrophilic
NLS Segment(s)
PositionSequence
19-24RRKRKK
Subcellular Location(s) mito 15, cyto 5, nucl 4, plas 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00149  Metallophos  
Amino Acid Sequences MPSTCTFPFSLLPKVLSVRRKRKKLRVQFVSDLHLEVGRQYSSFHIPVRGQILLLAGDIGQLQHYDDYRTFLATQCQKFQLVCLVLGNHEFYGLSRDEGLGLASKLETEPCLSGRLKVLNRNRVDISPSLCILGCTLQSHVTDTNRAEIEAKIKDFRRIKDWSVEKHNEEHVKDREWLLRQLSAVGDNYNVIVMTHHAPTVHGSSKPEDEGNTLTEAFATDLLGTDEAFSRPQWWVFGHTHHTTQMEKHGGILASNQRGYVLKPEAGASTRTFTRGLLCNTEQRRNRDAFDPGRFMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.44
4 0.5
5 0.55
6 0.63
7 0.73
8 0.8
9 0.86
10 0.91
11 0.92
12 0.93
13 0.92
14 0.9
15 0.88
16 0.81
17 0.75
18 0.65
19 0.55
20 0.44
21 0.34
22 0.26
23 0.18
24 0.17
25 0.12
26 0.11
27 0.11
28 0.14
29 0.18
30 0.21
31 0.21
32 0.24
33 0.24
34 0.27
35 0.3
36 0.27
37 0.22
38 0.2
39 0.19
40 0.14
41 0.14
42 0.1
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.07
51 0.08
52 0.11
53 0.11
54 0.15
55 0.15
56 0.17
57 0.17
58 0.16
59 0.24
60 0.29
61 0.31
62 0.31
63 0.33
64 0.33
65 0.32
66 0.31
67 0.3
68 0.23
69 0.21
70 0.18
71 0.17
72 0.16
73 0.17
74 0.17
75 0.1
76 0.09
77 0.08
78 0.07
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.12
99 0.12
100 0.13
101 0.15
102 0.22
103 0.23
104 0.31
105 0.38
106 0.42
107 0.43
108 0.46
109 0.45
110 0.39
111 0.39
112 0.33
113 0.28
114 0.21
115 0.2
116 0.17
117 0.15
118 0.14
119 0.12
120 0.1
121 0.08
122 0.07
123 0.08
124 0.09
125 0.09
126 0.11
127 0.13
128 0.13
129 0.15
130 0.14
131 0.17
132 0.15
133 0.15
134 0.14
135 0.13
136 0.16
137 0.15
138 0.15
139 0.17
140 0.17
141 0.25
142 0.28
143 0.29
144 0.31
145 0.33
146 0.34
147 0.39
148 0.43
149 0.41
150 0.45
151 0.48
152 0.44
153 0.43
154 0.46
155 0.42
156 0.38
157 0.4
158 0.34
159 0.32
160 0.32
161 0.31
162 0.31
163 0.29
164 0.31
165 0.25
166 0.24
167 0.22
168 0.21
169 0.19
170 0.16
171 0.14
172 0.11
173 0.1
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.04
180 0.06
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.11
187 0.15
188 0.16
189 0.16
190 0.17
191 0.19
192 0.21
193 0.22
194 0.21
195 0.18
196 0.17
197 0.17
198 0.17
199 0.16
200 0.14
201 0.13
202 0.12
203 0.11
204 0.09
205 0.08
206 0.07
207 0.05
208 0.05
209 0.06
210 0.06
211 0.06
212 0.06
213 0.07
214 0.08
215 0.09
216 0.08
217 0.1
218 0.11
219 0.12
220 0.14
221 0.14
222 0.18
223 0.2
224 0.24
225 0.29
226 0.3
227 0.32
228 0.32
229 0.33
230 0.29
231 0.29
232 0.32
233 0.3
234 0.27
235 0.26
236 0.27
237 0.25
238 0.24
239 0.27
240 0.26
241 0.27
242 0.27
243 0.26
244 0.24
245 0.24
246 0.25
247 0.27
248 0.25
249 0.21
250 0.22
251 0.23
252 0.24
253 0.25
254 0.27
255 0.21
256 0.22
257 0.21
258 0.23
259 0.22
260 0.2
261 0.24
262 0.28
263 0.3
264 0.33
265 0.35
266 0.42
267 0.48
268 0.58
269 0.59
270 0.59
271 0.62
272 0.59
273 0.59
274 0.56
275 0.58
276 0.57
277 0.58
278 0.56