Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YYU0

Protein Details
Accession W9YYU0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
407-439LLTGGKFDPKAKKRGRRAQRRARRRGYELSEADBasic
NLS Segment(s)
PositionSequence
415-432PKAKKRGRRAQRRARRRG
Subcellular Location(s) nucl 8.5, cyto_nucl 7.5, cyto 5.5, mito 5, extr 4, pero 2
Family & Domain DBs
Amino Acid Sequences MPLLQRVVKGIGSGIGLASEAIADHKEKKVAKEPGASPLRSAQLEAGEGSRSISRSAEAGRGEKERVGGEDGDYESDSDSDSSLDMDSSDLDNDKAEWALDDAAQQLEAPPPTYDEASSSSPASADELASAFLNTHQVARDPKKSYQPLPCPVILPQRRPKDKSRGFVRAYAPVLDTCSGIDQATFIDFLNGLDRASRASPVFDVVNLACFAVGFVPSPIAMGVSIAVQVASRTAQEVQSRHRRNTYLDQINETLFKPRGLYCMIMTFKPDSPHEPIIGMDVRSVDQALAKATSNPESEMRQKLKTLRLSSGATKGEMSLPESAPLIYPALEAALDRPAEMTPAKQNALKSSTGFVASYLDRRAQAAYAGMYPDSKLALAVPPPDKKFASRFSDPNHPANSGSLLALLTGGKFDPKAKKRGRRAQRRARRRGYELSEADIKNAEMGRLPRRRQGVIRRVLQQHVLYLTIVNLPTESEMKEMLQELDRKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.08
4 0.08
5 0.07
6 0.05
7 0.04
8 0.05
9 0.07
10 0.09
11 0.13
12 0.17
13 0.23
14 0.27
15 0.33
16 0.42
17 0.49
18 0.53
19 0.58
20 0.57
21 0.61
22 0.65
23 0.59
24 0.51
25 0.48
26 0.46
27 0.37
28 0.36
29 0.28
30 0.23
31 0.23
32 0.22
33 0.18
34 0.15
35 0.14
36 0.15
37 0.15
38 0.14
39 0.14
40 0.13
41 0.13
42 0.15
43 0.17
44 0.21
45 0.21
46 0.24
47 0.27
48 0.29
49 0.3
50 0.29
51 0.29
52 0.25
53 0.24
54 0.24
55 0.21
56 0.19
57 0.21
58 0.2
59 0.19
60 0.18
61 0.16
62 0.13
63 0.12
64 0.12
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.07
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.1
82 0.09
83 0.08
84 0.07
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.09
92 0.08
93 0.08
94 0.1
95 0.1
96 0.11
97 0.1
98 0.12
99 0.14
100 0.15
101 0.14
102 0.13
103 0.16
104 0.18
105 0.19
106 0.18
107 0.16
108 0.15
109 0.15
110 0.15
111 0.11
112 0.09
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.07
119 0.06
120 0.09
121 0.08
122 0.09
123 0.09
124 0.12
125 0.2
126 0.26
127 0.33
128 0.36
129 0.4
130 0.48
131 0.53
132 0.57
133 0.59
134 0.62
135 0.61
136 0.61
137 0.57
138 0.49
139 0.47
140 0.5
141 0.46
142 0.46
143 0.48
144 0.54
145 0.6
146 0.64
147 0.68
148 0.69
149 0.71
150 0.72
151 0.72
152 0.71
153 0.66
154 0.68
155 0.63
156 0.57
157 0.51
158 0.43
159 0.35
160 0.26
161 0.25
162 0.19
163 0.16
164 0.1
165 0.1
166 0.09
167 0.08
168 0.08
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.06
177 0.07
178 0.07
179 0.06
180 0.06
181 0.07
182 0.08
183 0.08
184 0.1
185 0.08
186 0.09
187 0.09
188 0.11
189 0.11
190 0.09
191 0.1
192 0.08
193 0.1
194 0.09
195 0.08
196 0.07
197 0.06
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.04
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.04
220 0.05
221 0.06
222 0.09
223 0.12
224 0.14
225 0.21
226 0.31
227 0.35
228 0.36
229 0.39
230 0.38
231 0.39
232 0.45
233 0.48
234 0.45
235 0.42
236 0.42
237 0.4
238 0.39
239 0.35
240 0.28
241 0.22
242 0.15
243 0.14
244 0.13
245 0.13
246 0.14
247 0.14
248 0.15
249 0.12
250 0.17
251 0.18
252 0.17
253 0.18
254 0.18
255 0.19
256 0.2
257 0.21
258 0.18
259 0.22
260 0.24
261 0.23
262 0.21
263 0.19
264 0.19
265 0.2
266 0.16
267 0.11
268 0.1
269 0.1
270 0.1
271 0.1
272 0.07
273 0.06
274 0.07
275 0.07
276 0.07
277 0.07
278 0.09
279 0.1
280 0.13
281 0.13
282 0.14
283 0.15
284 0.17
285 0.21
286 0.28
287 0.3
288 0.28
289 0.31
290 0.34
291 0.4
292 0.44
293 0.43
294 0.38
295 0.39
296 0.4
297 0.39
298 0.4
299 0.34
300 0.27
301 0.24
302 0.22
303 0.2
304 0.18
305 0.17
306 0.14
307 0.13
308 0.13
309 0.13
310 0.13
311 0.11
312 0.11
313 0.1
314 0.07
315 0.06
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.08
322 0.08
323 0.08
324 0.08
325 0.08
326 0.1
327 0.1
328 0.12
329 0.14
330 0.18
331 0.19
332 0.21
333 0.22
334 0.25
335 0.28
336 0.27
337 0.23
338 0.22
339 0.22
340 0.2
341 0.19
342 0.15
343 0.14
344 0.14
345 0.16
346 0.15
347 0.16
348 0.15
349 0.16
350 0.17
351 0.14
352 0.14
353 0.13
354 0.12
355 0.11
356 0.12
357 0.11
358 0.11
359 0.11
360 0.1
361 0.09
362 0.08
363 0.07
364 0.07
365 0.09
366 0.11
367 0.16
368 0.21
369 0.27
370 0.29
371 0.33
372 0.33
373 0.35
374 0.38
375 0.41
376 0.43
377 0.42
378 0.46
379 0.47
380 0.57
381 0.58
382 0.59
383 0.54
384 0.47
385 0.42
386 0.38
387 0.35
388 0.25
389 0.21
390 0.15
391 0.12
392 0.1
393 0.1
394 0.09
395 0.06
396 0.06
397 0.06
398 0.07
399 0.08
400 0.14
401 0.24
402 0.3
403 0.41
404 0.51
405 0.61
406 0.71
407 0.8
408 0.86
409 0.87
410 0.92
411 0.92
412 0.93
413 0.94
414 0.95
415 0.94
416 0.92
417 0.87
418 0.86
419 0.82
420 0.8
421 0.71
422 0.65
423 0.63
424 0.54
425 0.49
426 0.4
427 0.33
428 0.26
429 0.25
430 0.2
431 0.16
432 0.21
433 0.3
434 0.38
435 0.41
436 0.45
437 0.5
438 0.55
439 0.59
440 0.66
441 0.66
442 0.66
443 0.7
444 0.72
445 0.72
446 0.7
447 0.67
448 0.57
449 0.5
450 0.42
451 0.37
452 0.28
453 0.23
454 0.21
455 0.19
456 0.18
457 0.14
458 0.12
459 0.12
460 0.14
461 0.15
462 0.15
463 0.13
464 0.14
465 0.14
466 0.16
467 0.17
468 0.18
469 0.22
470 0.26