Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YIZ3

Protein Details
Accession W9YIZ3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
27-50GEAANPFDRRKKRRRDTQDGPRGDBasic
67-87GETFEKRRKIMQQRAAKKTHVHydrophilic
NLS Segment(s)
PositionSequence
35-41RRKKRRR
Subcellular Location(s) nucl 9, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MFGGEDWTGLGGLCDRIRRTVAHRSCGEAANPFDRRKKRRRDTQDGPRGDGLADGPRPGSGAGTGIGETFEKRRKIMQQRAAKKTHVQDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.2
5 0.22
6 0.26
7 0.34
8 0.38
9 0.42
10 0.42
11 0.44
12 0.45
13 0.44
14 0.4
15 0.33
16 0.3
17 0.29
18 0.32
19 0.3
20 0.36
21 0.43
22 0.5
23 0.55
24 0.64
25 0.67
26 0.74
27 0.81
28 0.83
29 0.84
30 0.87
31 0.87
32 0.78
33 0.71
34 0.6
35 0.5
36 0.4
37 0.3
38 0.2
39 0.14
40 0.12
41 0.1
42 0.09
43 0.09
44 0.09
45 0.09
46 0.08
47 0.05
48 0.06
49 0.06
50 0.06
51 0.07
52 0.06
53 0.07
54 0.07
55 0.08
56 0.12
57 0.18
58 0.2
59 0.21
60 0.27
61 0.36
62 0.47
63 0.56
64 0.61
65 0.65
66 0.74
67 0.81
68 0.8
69 0.75
70 0.72