Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K4K8

Protein Details
Accession J3K4K8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-102IQRVVRPRSRRGRLHPRRRETGBasic
NLS Segment(s)
PositionSequence
84-99VVRPRSRRGRLHPRRR
Subcellular Location(s) mito 19, cyto 5, extr 2
Family & Domain DBs
KEGG cim:CIMG_08005  -  
Amino Acid Sequences MALRVFDRTLVAGSPNSDVTTLIGLDRSGTQVVLRAPEVMILPLFETRLCAATADPGVNKDCRGPLVETVAAIGTGCLRRIQRVVRPRSRRGRLHPRRRETGLAGAPEGQPILRVVRMGFGIIDTVSQFGGREASYCVKLPARRTNQAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.14
5 0.13
6 0.12
7 0.12
8 0.11
9 0.09
10 0.09
11 0.08
12 0.09
13 0.09
14 0.1
15 0.09
16 0.09
17 0.08
18 0.11
19 0.12
20 0.13
21 0.13
22 0.12
23 0.11
24 0.13
25 0.13
26 0.1
27 0.09
28 0.07
29 0.08
30 0.07
31 0.08
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.07
39 0.09
40 0.11
41 0.1
42 0.1
43 0.1
44 0.12
45 0.13
46 0.13
47 0.12
48 0.11
49 0.11
50 0.14
51 0.13
52 0.13
53 0.16
54 0.15
55 0.14
56 0.13
57 0.12
58 0.1
59 0.08
60 0.07
61 0.04
62 0.05
63 0.05
64 0.07
65 0.08
66 0.09
67 0.12
68 0.16
69 0.22
70 0.31
71 0.41
72 0.48
73 0.55
74 0.63
75 0.71
76 0.75
77 0.75
78 0.76
79 0.78
80 0.79
81 0.83
82 0.84
83 0.81
84 0.8
85 0.77
86 0.71
87 0.62
88 0.59
89 0.52
90 0.43
91 0.36
92 0.32
93 0.27
94 0.24
95 0.21
96 0.12
97 0.08
98 0.08
99 0.09
100 0.08
101 0.09
102 0.08
103 0.1
104 0.11
105 0.11
106 0.1
107 0.08
108 0.08
109 0.07
110 0.08
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.08
118 0.07
119 0.08
120 0.12
121 0.16
122 0.18
123 0.19
124 0.22
125 0.27
126 0.31
127 0.38
128 0.45
129 0.49
130 0.55