Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Z3Z8

Protein Details
Accession W9Z3Z8    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-51TTNLIQVAPRCRRRCRQPAGASRSYNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007865  Aminopep_P_N  
IPR029149  Creatin/AminoP/Spt16_NTD  
IPR036005  Creatinase/aminopeptidase-like  
IPR000994  Pept_M24  
Gene Ontology GO:0030145  F:manganese ion binding  
GO:0070006  F:metalloaminopeptidase activity  
Pfam View protein in Pfam  
PF05195  AMP_N  
PF00557  Peptidase_M24  
Amino Acid Sequences MSMRRTLWQTLQCAHDVLNLRAGTTTTNLIQVAPRCRRRCRQPAGASRSYNTLTVDAADLSFGQPVHETHPHLLQPGELTPGITAQEYADRRTQLAAKLPDRAIAIVAASDIQFRSGSAFYEFHQDPDFLYLTGFNEPEALAVIGKDSSGSDHTFHLFVREKDPKAEIWDGARSGTQAARDVFNADETGDITRLKKVLPQLVGEASQVYTDITTPDPNRSALRRFLYGTSRKTTEFSELIEPSKVHRLRPVLNDLRAFKSPAEIEVMRRAGKASGRAHTEAMRKAWTREKDLDAYIRYRFVTDGCDTIAFEPVVAGGKNALGIHYVRNDDVLQDTEMVLVDGAGKYGGYISDITRTWPVGGKFSDAQRDLYQAVLTVQRSLISLCRGSANMSLDKLHSIAEDYLANELRQIGFDVTSKTIEALFPHHLSHYIGMDVHDTVGYTRKTVLQEGHCITIEPGIYVPDDERWPRHFRNMGVRIEDSISVQEDSAYVLTTEAVKEVVDIEALRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.32
4 0.28
5 0.31
6 0.27
7 0.26
8 0.26
9 0.26
10 0.21
11 0.19
12 0.2
13 0.14
14 0.17
15 0.17
16 0.17
17 0.21
18 0.26
19 0.34
20 0.41
21 0.5
22 0.54
23 0.63
24 0.72
25 0.79
26 0.83
27 0.83
28 0.84
29 0.85
30 0.88
31 0.88
32 0.87
33 0.8
34 0.7
35 0.66
36 0.56
37 0.48
38 0.38
39 0.3
40 0.22
41 0.19
42 0.19
43 0.14
44 0.12
45 0.1
46 0.09
47 0.09
48 0.1
49 0.09
50 0.08
51 0.1
52 0.11
53 0.16
54 0.2
55 0.23
56 0.24
57 0.29
58 0.29
59 0.29
60 0.29
61 0.24
62 0.21
63 0.19
64 0.2
65 0.15
66 0.14
67 0.13
68 0.14
69 0.13
70 0.11
71 0.11
72 0.08
73 0.15
74 0.16
75 0.19
76 0.23
77 0.23
78 0.23
79 0.26
80 0.29
81 0.25
82 0.32
83 0.37
84 0.35
85 0.41
86 0.4
87 0.4
88 0.37
89 0.34
90 0.26
91 0.18
92 0.16
93 0.09
94 0.09
95 0.07
96 0.06
97 0.07
98 0.06
99 0.07
100 0.07
101 0.07
102 0.1
103 0.1
104 0.11
105 0.13
106 0.14
107 0.13
108 0.21
109 0.21
110 0.2
111 0.21
112 0.2
113 0.17
114 0.2
115 0.2
116 0.12
117 0.12
118 0.12
119 0.12
120 0.14
121 0.13
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.08
128 0.06
129 0.05
130 0.06
131 0.05
132 0.05
133 0.05
134 0.04
135 0.06
136 0.08
137 0.1
138 0.1
139 0.12
140 0.13
141 0.14
142 0.14
143 0.18
144 0.2
145 0.2
146 0.27
147 0.33
148 0.33
149 0.35
150 0.36
151 0.32
152 0.33
153 0.34
154 0.27
155 0.23
156 0.24
157 0.22
158 0.21
159 0.2
160 0.14
161 0.14
162 0.14
163 0.12
164 0.13
165 0.13
166 0.14
167 0.14
168 0.15
169 0.14
170 0.13
171 0.12
172 0.09
173 0.08
174 0.07
175 0.08
176 0.08
177 0.08
178 0.08
179 0.1
180 0.1
181 0.1
182 0.12
183 0.16
184 0.2
185 0.22
186 0.22
187 0.22
188 0.23
189 0.24
190 0.21
191 0.17
192 0.11
193 0.09
194 0.08
195 0.06
196 0.05
197 0.04
198 0.05
199 0.06
200 0.09
201 0.1
202 0.13
203 0.14
204 0.15
205 0.18
206 0.2
207 0.22
208 0.25
209 0.27
210 0.26
211 0.26
212 0.28
213 0.33
214 0.37
215 0.37
216 0.35
217 0.34
218 0.33
219 0.33
220 0.31
221 0.27
222 0.22
223 0.2
224 0.2
225 0.2
226 0.2
227 0.2
228 0.19
229 0.16
230 0.24
231 0.23
232 0.19
233 0.23
234 0.25
235 0.29
236 0.33
237 0.4
238 0.36
239 0.38
240 0.41
241 0.39
242 0.38
243 0.34
244 0.31
245 0.22
246 0.2
247 0.17
248 0.14
249 0.16
250 0.14
251 0.14
252 0.18
253 0.2
254 0.18
255 0.18
256 0.18
257 0.15
258 0.16
259 0.22
260 0.2
261 0.22
262 0.25
263 0.27
264 0.27
265 0.3
266 0.33
267 0.28
268 0.26
269 0.27
270 0.24
271 0.26
272 0.32
273 0.31
274 0.32
275 0.34
276 0.35
277 0.34
278 0.35
279 0.36
280 0.31
281 0.3
282 0.25
283 0.23
284 0.2
285 0.18
286 0.16
287 0.13
288 0.15
289 0.13
290 0.13
291 0.12
292 0.12
293 0.12
294 0.12
295 0.14
296 0.1
297 0.09
298 0.07
299 0.07
300 0.08
301 0.07
302 0.07
303 0.05
304 0.05
305 0.06
306 0.06
307 0.06
308 0.06
309 0.07
310 0.09
311 0.11
312 0.12
313 0.11
314 0.13
315 0.12
316 0.12
317 0.13
318 0.12
319 0.1
320 0.1
321 0.1
322 0.09
323 0.09
324 0.08
325 0.06
326 0.05
327 0.05
328 0.04
329 0.04
330 0.04
331 0.04
332 0.04
333 0.04
334 0.04
335 0.04
336 0.05
337 0.06
338 0.1
339 0.1
340 0.12
341 0.13
342 0.14
343 0.14
344 0.17
345 0.18
346 0.19
347 0.19
348 0.21
349 0.23
350 0.25
351 0.31
352 0.28
353 0.3
354 0.26
355 0.28
356 0.25
357 0.22
358 0.2
359 0.13
360 0.14
361 0.14
362 0.14
363 0.12
364 0.12
365 0.12
366 0.12
367 0.13
368 0.14
369 0.13
370 0.13
371 0.13
372 0.15
373 0.15
374 0.16
375 0.19
376 0.21
377 0.2
378 0.2
379 0.2
380 0.19
381 0.2
382 0.18
383 0.15
384 0.11
385 0.11
386 0.1
387 0.11
388 0.11
389 0.11
390 0.14
391 0.15
392 0.14
393 0.12
394 0.13
395 0.12
396 0.11
397 0.12
398 0.1
399 0.1
400 0.12
401 0.14
402 0.15
403 0.15
404 0.15
405 0.14
406 0.14
407 0.13
408 0.13
409 0.15
410 0.18
411 0.19
412 0.19
413 0.2
414 0.2
415 0.21
416 0.22
417 0.18
418 0.15
419 0.14
420 0.14
421 0.15
422 0.13
423 0.12
424 0.1
425 0.09
426 0.09
427 0.15
428 0.15
429 0.14
430 0.15
431 0.2
432 0.22
433 0.25
434 0.32
435 0.3
436 0.38
437 0.4
438 0.42
439 0.37
440 0.36
441 0.32
442 0.28
443 0.24
444 0.16
445 0.14
446 0.11
447 0.12
448 0.12
449 0.12
450 0.13
451 0.18
452 0.21
453 0.25
454 0.3
455 0.37
456 0.4
457 0.49
458 0.5
459 0.51
460 0.59
461 0.62
462 0.63
463 0.6
464 0.58
465 0.51
466 0.47
467 0.42
468 0.32
469 0.26
470 0.22
471 0.18
472 0.16
473 0.14
474 0.12
475 0.13
476 0.12
477 0.1
478 0.08
479 0.08
480 0.09
481 0.1
482 0.1
483 0.09
484 0.09
485 0.08
486 0.08
487 0.09
488 0.09
489 0.09