Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9YLJ3

Protein Details
Accession W9YLJ3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-41APSASSGGKKQKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
20-36GGKKQKKKWSKGKVKDK
Subcellular Location(s) mito 10, nucl 6.5, cyto_nucl 6.5, cyto 5.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MTMFAQNYHRQLPAPSASSGGKKQKKKWSKGKVKDKAQHAVVLDKAISDKLNKDVQSYRLITVAVLVDRLKINGSLARRALADLEDRGVIRKVVGHHTGSIYTRAAADSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.26
4 0.27
5 0.3
6 0.36
7 0.4
8 0.44
9 0.48
10 0.57
11 0.65
12 0.73
13 0.79
14 0.83
15 0.84
16 0.86
17 0.9
18 0.92
19 0.91
20 0.91
21 0.88
22 0.83
23 0.79
24 0.69
25 0.62
26 0.51
27 0.44
28 0.34
29 0.28
30 0.21
31 0.14
32 0.13
33 0.1
34 0.1
35 0.08
36 0.08
37 0.12
38 0.16
39 0.16
40 0.18
41 0.2
42 0.22
43 0.26
44 0.26
45 0.23
46 0.19
47 0.19
48 0.16
49 0.15
50 0.13
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.08
60 0.11
61 0.13
62 0.16
63 0.17
64 0.17
65 0.17
66 0.17
67 0.17
68 0.15
69 0.15
70 0.12
71 0.13
72 0.13
73 0.13
74 0.14
75 0.14
76 0.13
77 0.11
78 0.13
79 0.15
80 0.2
81 0.25
82 0.25
83 0.26
84 0.28
85 0.31
86 0.29
87 0.29
88 0.24
89 0.2
90 0.19