Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9YV30

Protein Details
Accession W9YV30    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-52ALKVRHDKKKQARKTEGDEIFBasic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 4, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQSDFKMSPIAWLVIAIFASIILIIALVYLFALKVRHDKKKQARKTEGDEIFGAMIANPITR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.08
4 0.05
5 0.04
6 0.04
7 0.04
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.03
19 0.03
20 0.04
21 0.13
22 0.18
23 0.28
24 0.33
25 0.43
26 0.53
27 0.64
28 0.73
29 0.75
30 0.79
31 0.77
32 0.8
33 0.81
34 0.72
35 0.65
36 0.56
37 0.46
38 0.37
39 0.3
40 0.22
41 0.12
42 0.11