Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3KAJ4

Protein Details
Accession J3KAJ4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-32KPPIKVPSSREKPMRPRDAPRGPSBasic
118-144QGAVKGYDKRRLKNKRGCGNNDKSRDVHydrophilic
NLS Segment(s)
PositionSequence
17-25SREKPMRPR
126-130KRRLK
Subcellular Location(s) mito 18, nucl 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
KEGG cim:CIMG_03070  -  
Amino Acid Sequences MTARDHAAKPPIKVPSSREKPMRPRDAPRGPSEARGECLLVTRSGPSVVGEGSTIIRILCHEIPPPQEEGSGTNPGYIGISNVIFGLVACQPSRVPNTYSDLKLFREYAKREKVENRQGAVKGYDKRRLKNKRGCGNNDKSRDVDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.53
4 0.58
5 0.6
6 0.62
7 0.69
8 0.76
9 0.81
10 0.76
11 0.76
12 0.79
13 0.81
14 0.77
15 0.71
16 0.68
17 0.59
18 0.58
19 0.55
20 0.47
21 0.39
22 0.35
23 0.31
24 0.23
25 0.24
26 0.2
27 0.15
28 0.13
29 0.12
30 0.11
31 0.11
32 0.11
33 0.09
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.09
46 0.09
47 0.1
48 0.11
49 0.13
50 0.15
51 0.17
52 0.19
53 0.15
54 0.14
55 0.13
56 0.15
57 0.16
58 0.17
59 0.15
60 0.14
61 0.13
62 0.13
63 0.13
64 0.1
65 0.07
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.05
74 0.05
75 0.07
76 0.06
77 0.07
78 0.08
79 0.1
80 0.14
81 0.14
82 0.15
83 0.17
84 0.22
85 0.26
86 0.27
87 0.28
88 0.27
89 0.27
90 0.28
91 0.27
92 0.26
93 0.3
94 0.33
95 0.39
96 0.46
97 0.46
98 0.48
99 0.55
100 0.61
101 0.64
102 0.65
103 0.59
104 0.56
105 0.55
106 0.53
107 0.48
108 0.45
109 0.42
110 0.43
111 0.49
112 0.49
113 0.56
114 0.64
115 0.71
116 0.75
117 0.78
118 0.81
119 0.82
120 0.86
121 0.88
122 0.88
123 0.88
124 0.87
125 0.83
126 0.76