Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XW67

Protein Details
Accession W9XW67   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-70SEDKSGKTKGRSRQERSERRSKKLKKSKENRSHATAEBasic
237-268MSKIKGKNDKLNEERKRRSTKDKSEQKKAAAQHydrophilic
NLS Segment(s)
PositionSequence
39-63GKTKGRSRQERSERRSKKLKKSKEN
205-272KSGEKAAGGKTKGRKINVELTAGGGGKKSQERMSKIKGKNDKLNEERKRRSTKDKSEQKKAAAQGKKP
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034228  Nop6_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12400  RRM_Nop6  
Amino Acid Sequences MSIKRKRDQDESEAHLVQAEAATTTQHNGATQDSEDKSGKTKGRSRQERSERRSKKLKKSKENRSHATAEVDTVPVDNKAAPPLEVEATAPDQNQSALDSELSQNLSTKTKKPQKAASDEKKSAQAPTRFIVFVGNLPFNATASQVRDHFSKLAPSSVRLSTDKATGKSKGFAFLEFDAYDKMKTCLKLYHHSLFDPEGKANVGKSGEKAAGGKTKGRKINVELTAGGGGKKSQERMSKIKGKNDKLNEERKRRSTKDKSEQKKAAAQGKKPPVTGANAAEATEAVQDDRGAIHPSRLSRVGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.44
3 0.37
4 0.29
5 0.21
6 0.14
7 0.08
8 0.07
9 0.08
10 0.08
11 0.1
12 0.11
13 0.11
14 0.12
15 0.12
16 0.14
17 0.15
18 0.16
19 0.21
20 0.2
21 0.24
22 0.25
23 0.25
24 0.27
25 0.32
26 0.35
27 0.37
28 0.44
29 0.49
30 0.59
31 0.69
32 0.73
33 0.77
34 0.83
35 0.85
36 0.86
37 0.88
38 0.84
39 0.82
40 0.85
41 0.84
42 0.84
43 0.84
44 0.87
45 0.87
46 0.9
47 0.92
48 0.92
49 0.92
50 0.87
51 0.83
52 0.76
53 0.67
54 0.62
55 0.51
56 0.42
57 0.33
58 0.27
59 0.2
60 0.16
61 0.14
62 0.09
63 0.1
64 0.08
65 0.08
66 0.1
67 0.1
68 0.1
69 0.1
70 0.12
71 0.12
72 0.12
73 0.12
74 0.11
75 0.13
76 0.14
77 0.13
78 0.11
79 0.11
80 0.11
81 0.1
82 0.1
83 0.08
84 0.08
85 0.08
86 0.09
87 0.09
88 0.11
89 0.11
90 0.11
91 0.11
92 0.12
93 0.17
94 0.18
95 0.21
96 0.3
97 0.38
98 0.44
99 0.48
100 0.55
101 0.58
102 0.65
103 0.72
104 0.72
105 0.71
106 0.68
107 0.64
108 0.6
109 0.53
110 0.47
111 0.44
112 0.38
113 0.31
114 0.3
115 0.31
116 0.26
117 0.25
118 0.23
119 0.16
120 0.14
121 0.14
122 0.13
123 0.1
124 0.11
125 0.11
126 0.1
127 0.1
128 0.09
129 0.08
130 0.09
131 0.11
132 0.11
133 0.13
134 0.13
135 0.14
136 0.14
137 0.13
138 0.15
139 0.14
140 0.17
141 0.16
142 0.17
143 0.19
144 0.19
145 0.21
146 0.18
147 0.2
148 0.17
149 0.22
150 0.23
151 0.23
152 0.25
153 0.25
154 0.25
155 0.27
156 0.26
157 0.25
158 0.23
159 0.21
160 0.21
161 0.19
162 0.2
163 0.17
164 0.17
165 0.13
166 0.13
167 0.13
168 0.11
169 0.11
170 0.12
171 0.13
172 0.14
173 0.18
174 0.22
175 0.29
176 0.34
177 0.39
178 0.37
179 0.37
180 0.37
181 0.34
182 0.34
183 0.28
184 0.22
185 0.16
186 0.16
187 0.16
188 0.15
189 0.15
190 0.13
191 0.12
192 0.13
193 0.15
194 0.15
195 0.15
196 0.16
197 0.16
198 0.2
199 0.21
200 0.26
201 0.3
202 0.37
203 0.41
204 0.43
205 0.44
206 0.43
207 0.51
208 0.48
209 0.45
210 0.37
211 0.33
212 0.33
213 0.29
214 0.24
215 0.15
216 0.12
217 0.12
218 0.15
219 0.16
220 0.21
221 0.27
222 0.33
223 0.4
224 0.49
225 0.56
226 0.59
227 0.66
228 0.69
229 0.7
230 0.73
231 0.74
232 0.75
233 0.73
234 0.78
235 0.79
236 0.79
237 0.81
238 0.81
239 0.83
240 0.79
241 0.82
242 0.82
243 0.83
244 0.84
245 0.85
246 0.85
247 0.86
248 0.87
249 0.81
250 0.77
251 0.74
252 0.72
253 0.69
254 0.66
255 0.65
256 0.69
257 0.68
258 0.61
259 0.57
260 0.5
261 0.48
262 0.47
263 0.4
264 0.35
265 0.32
266 0.31
267 0.28
268 0.25
269 0.2
270 0.16
271 0.13
272 0.08
273 0.08
274 0.08
275 0.08
276 0.1
277 0.11
278 0.14
279 0.15
280 0.19
281 0.22
282 0.25
283 0.3