Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XJA2

Protein Details
Accession W9XJA2   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-34HIDLPTVPKPKPKRKGLPKKDEVVESBasic
150-173AVREQELRRRNKEKEEKEREREAEBasic
NLS Segment(s)
PositionSequence
17-28KPKPKRKGLPKK
157-171RRRNKEKEEKERERE
Subcellular Location(s) nucl 20, cyto 3.5, cyto_mito 3.5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MESKLASLHIDLPTVPKPKPKRKGLPKKDEVVESWEDDDLSSLDDTPTPTEGAGSELKPAMSQDPALKPPPPTPISPENADQHIDWAPAQVLGGGRPKPYGAPSPSTPTDIDREQRRPETTTATASRLIAAGLGIKPPKKTEEQRQYDRAVREQELRRRNKEKEEKEREREAEEKAKAAVWDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.33
4 0.42
5 0.52
6 0.62
7 0.68
8 0.73
9 0.8
10 0.9
11 0.92
12 0.93
13 0.9
14 0.88
15 0.82
16 0.74
17 0.65
18 0.59
19 0.51
20 0.41
21 0.35
22 0.26
23 0.22
24 0.18
25 0.17
26 0.11
27 0.1
28 0.08
29 0.07
30 0.07
31 0.08
32 0.09
33 0.1
34 0.11
35 0.09
36 0.09
37 0.09
38 0.09
39 0.11
40 0.12
41 0.11
42 0.11
43 0.12
44 0.12
45 0.12
46 0.12
47 0.1
48 0.09
49 0.1
50 0.13
51 0.16
52 0.19
53 0.21
54 0.22
55 0.23
56 0.24
57 0.3
58 0.28
59 0.26
60 0.28
61 0.32
62 0.33
63 0.34
64 0.35
65 0.3
66 0.29
67 0.29
68 0.23
69 0.2
70 0.17
71 0.15
72 0.11
73 0.09
74 0.08
75 0.07
76 0.07
77 0.06
78 0.05
79 0.06
80 0.1
81 0.1
82 0.11
83 0.11
84 0.11
85 0.11
86 0.13
87 0.18
88 0.16
89 0.2
90 0.22
91 0.27
92 0.28
93 0.3
94 0.28
95 0.24
96 0.25
97 0.23
98 0.27
99 0.28
100 0.32
101 0.34
102 0.38
103 0.39
104 0.38
105 0.37
106 0.38
107 0.34
108 0.35
109 0.32
110 0.3
111 0.29
112 0.26
113 0.25
114 0.19
115 0.16
116 0.1
117 0.08
118 0.08
119 0.07
120 0.1
121 0.12
122 0.14
123 0.15
124 0.17
125 0.21
126 0.27
127 0.34
128 0.42
129 0.51
130 0.58
131 0.65
132 0.69
133 0.71
134 0.69
135 0.65
136 0.6
137 0.54
138 0.48
139 0.49
140 0.52
141 0.56
142 0.59
143 0.64
144 0.68
145 0.71
146 0.74
147 0.76
148 0.78
149 0.8
150 0.81
151 0.84
152 0.85
153 0.84
154 0.88
155 0.79
156 0.74
157 0.67
158 0.63
159 0.61
160 0.53
161 0.47
162 0.39
163 0.38