Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YJH3

Protein Details
Accession W9YJH3   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
445-471ITPRTLVTKKEMKKNRKKDGLKVLSEDHydrophilic
NLS Segment(s)
PositionSequence
455-462EMKKNRKK
Subcellular Location(s) plas 13, extr 6, E.R. 4, nucl 2, mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRCCASCSTLVSFTFTFVLLGLPVAARPHSIWDIDILTGPAPPPDEGPPLSAGALRDKSQLKYEVVGIVAAYVAWLLLTFLLLVFVGQKLRRKTQTSDRSLSMEIIKPAPLGNQAKMSTEPPLKSPGKMASLRSWATGGKSHTRNPSNMSASTVDERILEADKARNMDEMAKLYAAVMAHDEEKSEKARSSGQLSPRSPQFRSQDNAPPTPRSPNYPPTPRSPYYPAHYGLASPRSPKYPLEFQDLQKPSSQAQIYAVQPLASPLFHPLAPTPAEEFASPSTDSRSSSRKTRISGLSILPGRSDSADKGKRRPSAISVRGQPISQPLGSATLTDASVYSVAGTVSPRIYNPGPPPPTPGQQPAWDSTQDIGKNPPAAASVRSAAASHSSNSLPFRQFYNETLKSAPATKTTFVDRRESVLGVHPKTGVPQTPYSPYMPFTPMTPITPRTLVTKKEMKKNRKKDGLKVLSEDDMVMSDEDMWGELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.18
4 0.13
5 0.13
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.09
12 0.09
13 0.1
14 0.1
15 0.16
16 0.18
17 0.18
18 0.18
19 0.19
20 0.2
21 0.19
22 0.2
23 0.15
24 0.13
25 0.13
26 0.13
27 0.12
28 0.12
29 0.12
30 0.13
31 0.16
32 0.2
33 0.2
34 0.22
35 0.22
36 0.22
37 0.22
38 0.21
39 0.19
40 0.22
41 0.24
42 0.23
43 0.27
44 0.3
45 0.31
46 0.35
47 0.38
48 0.33
49 0.32
50 0.32
51 0.28
52 0.25
53 0.23
54 0.17
55 0.13
56 0.11
57 0.08
58 0.06
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.1
74 0.13
75 0.2
76 0.25
77 0.33
78 0.4
79 0.45
80 0.5
81 0.57
82 0.65
83 0.67
84 0.67
85 0.61
86 0.58
87 0.54
88 0.49
89 0.42
90 0.35
91 0.29
92 0.25
93 0.23
94 0.19
95 0.19
96 0.18
97 0.22
98 0.21
99 0.21
100 0.25
101 0.25
102 0.27
103 0.29
104 0.28
105 0.27
106 0.29
107 0.28
108 0.24
109 0.32
110 0.32
111 0.31
112 0.33
113 0.31
114 0.33
115 0.36
116 0.37
117 0.34
118 0.39
119 0.39
120 0.36
121 0.33
122 0.27
123 0.25
124 0.27
125 0.25
126 0.27
127 0.3
128 0.35
129 0.43
130 0.45
131 0.46
132 0.46
133 0.5
134 0.45
135 0.42
136 0.4
137 0.32
138 0.31
139 0.31
140 0.26
141 0.19
142 0.15
143 0.14
144 0.13
145 0.12
146 0.1
147 0.1
148 0.13
149 0.14
150 0.15
151 0.16
152 0.15
153 0.14
154 0.17
155 0.17
156 0.16
157 0.15
158 0.13
159 0.13
160 0.12
161 0.13
162 0.1
163 0.08
164 0.07
165 0.07
166 0.08
167 0.08
168 0.08
169 0.08
170 0.1
171 0.12
172 0.12
173 0.12
174 0.13
175 0.17
176 0.19
177 0.23
178 0.27
179 0.32
180 0.4
181 0.4
182 0.42
183 0.45
184 0.47
185 0.42
186 0.44
187 0.41
188 0.37
189 0.39
190 0.4
191 0.42
192 0.43
193 0.47
194 0.42
195 0.42
196 0.38
197 0.42
198 0.38
199 0.35
200 0.36
201 0.38
202 0.43
203 0.48
204 0.49
205 0.49
206 0.56
207 0.51
208 0.51
209 0.48
210 0.44
211 0.4
212 0.42
213 0.36
214 0.3
215 0.28
216 0.25
217 0.22
218 0.23
219 0.2
220 0.17
221 0.17
222 0.18
223 0.2
224 0.2
225 0.22
226 0.25
227 0.26
228 0.32
229 0.35
230 0.34
231 0.42
232 0.42
233 0.39
234 0.34
235 0.32
236 0.25
237 0.26
238 0.25
239 0.16
240 0.17
241 0.2
242 0.18
243 0.19
244 0.19
245 0.13
246 0.13
247 0.13
248 0.11
249 0.07
250 0.07
251 0.07
252 0.09
253 0.08
254 0.09
255 0.09
256 0.11
257 0.12
258 0.12
259 0.11
260 0.11
261 0.12
262 0.11
263 0.12
264 0.1
265 0.12
266 0.12
267 0.1
268 0.12
269 0.13
270 0.14
271 0.16
272 0.21
273 0.21
274 0.28
275 0.36
276 0.37
277 0.39
278 0.44
279 0.45
280 0.43
281 0.44
282 0.38
283 0.37
284 0.35
285 0.32
286 0.26
287 0.22
288 0.19
289 0.16
290 0.16
291 0.11
292 0.19
293 0.26
294 0.29
295 0.36
296 0.43
297 0.46
298 0.47
299 0.48
300 0.46
301 0.49
302 0.52
303 0.52
304 0.5
305 0.5
306 0.49
307 0.46
308 0.39
309 0.32
310 0.29
311 0.22
312 0.17
313 0.13
314 0.15
315 0.15
316 0.14
317 0.11
318 0.09
319 0.09
320 0.09
321 0.08
322 0.06
323 0.06
324 0.06
325 0.05
326 0.05
327 0.05
328 0.05
329 0.06
330 0.07
331 0.08
332 0.09
333 0.09
334 0.13
335 0.14
336 0.19
337 0.23
338 0.31
339 0.34
340 0.34
341 0.41
342 0.41
343 0.44
344 0.43
345 0.43
346 0.37
347 0.38
348 0.4
349 0.36
350 0.35
351 0.32
352 0.29
353 0.24
354 0.27
355 0.23
356 0.22
357 0.22
358 0.22
359 0.24
360 0.22
361 0.22
362 0.18
363 0.18
364 0.19
365 0.18
366 0.16
367 0.15
368 0.15
369 0.15
370 0.13
371 0.16
372 0.16
373 0.14
374 0.15
375 0.15
376 0.17
377 0.2
378 0.25
379 0.23
380 0.23
381 0.25
382 0.28
383 0.3
384 0.31
385 0.38
386 0.36
387 0.36
388 0.36
389 0.35
390 0.31
391 0.33
392 0.31
393 0.26
394 0.27
395 0.26
396 0.28
397 0.34
398 0.38
399 0.37
400 0.42
401 0.37
402 0.39
403 0.39
404 0.37
405 0.31
406 0.34
407 0.39
408 0.34
409 0.35
410 0.31
411 0.29
412 0.32
413 0.35
414 0.3
415 0.27
416 0.3
417 0.32
418 0.36
419 0.39
420 0.38
421 0.35
422 0.32
423 0.31
424 0.29
425 0.26
426 0.22
427 0.26
428 0.25
429 0.28
430 0.3
431 0.29
432 0.31
433 0.33
434 0.32
435 0.33
436 0.37
437 0.37
438 0.41
439 0.48
440 0.51
441 0.6
442 0.69
443 0.73
444 0.78
445 0.85
446 0.88
447 0.89
448 0.89
449 0.88
450 0.9
451 0.88
452 0.83
453 0.77
454 0.69
455 0.61
456 0.54
457 0.44
458 0.33
459 0.24
460 0.19
461 0.14
462 0.11
463 0.09
464 0.09
465 0.08