Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1S007

Protein Details
Accession A0A0E1S007    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-106IISVVPGRRNKPKKRTRQHVPLFHHLRGHydrophilic
NLS Segment(s)
PositionSequence
86-94RRNKPKKRT
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 5, cyto 3.5
Family & Domain DBs
KEGG cim:CIMG_13551  -  
Amino Acid Sequences MWRHPPNSYSKNKSEHGEYGKNFFASSKYGNNSRAFAEDATGDHFILPEVEVGSTDSAGNSTSQCWETQELQEIGDYGIISVVPGRRNKPKKRTRQHVPLFHHLRGFDTGIVSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.56
4 0.57
5 0.51
6 0.49
7 0.48
8 0.45
9 0.39
10 0.31
11 0.25
12 0.2
13 0.21
14 0.22
15 0.24
16 0.28
17 0.33
18 0.34
19 0.34
20 0.32
21 0.3
22 0.26
23 0.22
24 0.18
25 0.14
26 0.12
27 0.13
28 0.13
29 0.11
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.05
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.09
53 0.11
54 0.13
55 0.14
56 0.18
57 0.17
58 0.16
59 0.16
60 0.15
61 0.13
62 0.11
63 0.1
64 0.05
65 0.05
66 0.04
67 0.04
68 0.06
69 0.08
70 0.12
71 0.16
72 0.21
73 0.32
74 0.42
75 0.52
76 0.61
77 0.69
78 0.76
79 0.84
80 0.9
81 0.9
82 0.91
83 0.91
84 0.91
85 0.88
86 0.88
87 0.83
88 0.75
89 0.68
90 0.57
91 0.5
92 0.43
93 0.37
94 0.27
95 0.22