Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XUL9

Protein Details
Accession W9XUL9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDAPQTSKQTKNRPRETVKLLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 12, cyto 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013096  Cupin_2  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Pfam View protein in Pfam  
PF07883  Cupin_2  
CDD cd02234  cupin_BLR7677-like  
Amino Acid Sequences MDAPQTSKQTKNRPRETVKLLYDYKLENAPGKSIVGLQVHLPPGGFTPPHRHGGATVVATVTDGQFLSGMNGNPPVVYGVGQSFMERPGCHHTVAENNSQEKPTSFTAVFVVDSEVVENGYAGLTVLDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.8
4 0.78
5 0.73
6 0.69
7 0.62
8 0.54
9 0.49
10 0.42
11 0.36
12 0.29
13 0.26
14 0.24
15 0.22
16 0.22
17 0.2
18 0.19
19 0.17
20 0.15
21 0.18
22 0.14
23 0.13
24 0.13
25 0.15
26 0.16
27 0.15
28 0.15
29 0.11
30 0.11
31 0.12
32 0.12
33 0.1
34 0.17
35 0.2
36 0.24
37 0.25
38 0.24
39 0.22
40 0.25
41 0.26
42 0.18
43 0.15
44 0.11
45 0.1
46 0.1
47 0.1
48 0.07
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.07
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.05
64 0.05
65 0.06
66 0.05
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.1
73 0.1
74 0.12
75 0.18
76 0.19
77 0.2
78 0.19
79 0.2
80 0.25
81 0.29
82 0.33
83 0.31
84 0.32
85 0.33
86 0.34
87 0.33
88 0.26
89 0.26
90 0.21
91 0.22
92 0.19
93 0.19
94 0.19
95 0.2
96 0.19
97 0.16
98 0.15
99 0.11
100 0.11
101 0.1
102 0.09
103 0.08
104 0.08
105 0.07
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04