Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9W834

Protein Details
Accession W9W834    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-59ETVQHRSRLKIRPPPKNLRQVHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005302  MoCF_Sase_C  
IPR011037  Pyrv_Knase-like_insert_dom_sf  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030151  F:molybdenum ion binding  
GO:0030170  F:pyridoxal phosphate binding  
Pfam View protein in Pfam  
PF03473  MOSC  
PROSITE View protein in PROSITE  
PS51340  MOSC  
Amino Acid Sequences MSVHALSFSAQHNFSKQSSNTLTLLPDLGVKGDCHCGETVQHRSRLKIRPPPKNLRQVHLIDLEILDELKVKPGELGENITTKGVKLLELGAGTRLHLMSPAATATGTGTTGSDLKDGGPGAGIVQERSETAGHPVLVVTGLRNPCPQINHFRSGLQERFVERDEQRAIVVRKAGIMSTVEVGGAIEVGMRIVVEQPAVWKALECV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.3
4 0.34
5 0.36
6 0.39
7 0.36
8 0.34
9 0.33
10 0.26
11 0.26
12 0.18
13 0.15
14 0.11
15 0.11
16 0.11
17 0.11
18 0.12
19 0.16
20 0.16
21 0.17
22 0.17
23 0.16
24 0.19
25 0.26
26 0.34
27 0.34
28 0.42
29 0.41
30 0.45
31 0.53
32 0.58
33 0.6
34 0.6
35 0.64
36 0.67
37 0.75
38 0.81
39 0.82
40 0.84
41 0.78
42 0.72
43 0.7
44 0.61
45 0.56
46 0.48
47 0.39
48 0.29
49 0.26
50 0.22
51 0.14
52 0.12
53 0.07
54 0.06
55 0.06
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.12
62 0.11
63 0.14
64 0.12
65 0.14
66 0.14
67 0.14
68 0.13
69 0.11
70 0.12
71 0.09
72 0.08
73 0.07
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.06
84 0.06
85 0.06
86 0.04
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.08
110 0.08
111 0.06
112 0.07
113 0.07
114 0.07
115 0.09
116 0.09
117 0.06
118 0.09
119 0.11
120 0.11
121 0.11
122 0.11
123 0.09
124 0.09
125 0.09
126 0.07
127 0.1
128 0.11
129 0.12
130 0.13
131 0.15
132 0.17
133 0.2
134 0.23
135 0.28
136 0.33
137 0.36
138 0.36
139 0.36
140 0.38
141 0.42
142 0.41
143 0.33
144 0.3
145 0.28
146 0.3
147 0.31
148 0.32
149 0.25
150 0.3
151 0.29
152 0.27
153 0.26
154 0.3
155 0.3
156 0.27
157 0.29
158 0.23
159 0.23
160 0.23
161 0.22
162 0.16
163 0.15
164 0.14
165 0.12
166 0.12
167 0.1
168 0.09
169 0.09
170 0.07
171 0.06
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.05
180 0.06
181 0.06
182 0.07
183 0.09
184 0.11
185 0.13
186 0.12