Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9W774

Protein Details
Accession W9W774   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
7-27LTTCRRLIPKADRKKIHEYIFHydrophilic
NLS Segment(s)
PositionSequence
121-153RGERRGGGRGGPRGDREGGYRRREDRGEGKEGG
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037447  Rps10  
IPR005326  S10_plectin_N  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03501  S10_plectin  
Amino Acid Sequences MESLPILTTCRRLIPKADRKKIHEYIFREGVLVAKKDFNLPKHGDIDTKNLYVIKACQSLTSRGYLKTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPATHIKQQRSHAPPRGMMGGDDRGERRGGGRGGPRGDREGGYRRREDRGEGKEGGAPGEFAPTFRGGFGRGRGAPPAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.55
3 0.62
4 0.71
5 0.71
6 0.74
7 0.81
8 0.81
9 0.78
10 0.76
11 0.7
12 0.68
13 0.65
14 0.58
15 0.49
16 0.4
17 0.36
18 0.32
19 0.28
20 0.21
21 0.19
22 0.19
23 0.25
24 0.3
25 0.28
26 0.32
27 0.34
28 0.37
29 0.38
30 0.38
31 0.36
32 0.33
33 0.37
34 0.33
35 0.29
36 0.26
37 0.23
38 0.23
39 0.2
40 0.2
41 0.18
42 0.17
43 0.17
44 0.19
45 0.21
46 0.24
47 0.24
48 0.26
49 0.24
50 0.22
51 0.25
52 0.25
53 0.25
54 0.23
55 0.27
56 0.27
57 0.27
58 0.28
59 0.26
60 0.25
61 0.24
62 0.25
63 0.2
64 0.18
65 0.16
66 0.14
67 0.13
68 0.1
69 0.1
70 0.08
71 0.08
72 0.07
73 0.08
74 0.08
75 0.08
76 0.09
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.09
83 0.08
84 0.07
85 0.08
86 0.09
87 0.1
88 0.14
89 0.17
90 0.17
91 0.22
92 0.25
93 0.34
94 0.39
95 0.46
96 0.49
97 0.48
98 0.48
99 0.45
100 0.44
101 0.35
102 0.29
103 0.25
104 0.21
105 0.18
106 0.19
107 0.18
108 0.17
109 0.17
110 0.16
111 0.14
112 0.16
113 0.16
114 0.19
115 0.24
116 0.28
117 0.32
118 0.35
119 0.36
120 0.34
121 0.35
122 0.31
123 0.31
124 0.35
125 0.39
126 0.42
127 0.46
128 0.46
129 0.5
130 0.51
131 0.52
132 0.52
133 0.5
134 0.51
135 0.46
136 0.44
137 0.41
138 0.4
139 0.34
140 0.25
141 0.19
142 0.13
143 0.16
144 0.15
145 0.12
146 0.15
147 0.15
148 0.15
149 0.15
150 0.16
151 0.14
152 0.18
153 0.21
154 0.26
155 0.27
156 0.29