Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VKX6

Protein Details
Accession W9VKX6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-35KGKGPPPKPAPTSKPRRSKLAKDNDITHydrophilic
NLS Segment(s)
PositionSequence
3-28PRKPPAKGKGPPPKPAPTSKPRRSKL
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
Amino Acid Sequences MPPRKPPAKGKGPPPKPAPTSKPRRSKLAKDNDITAEEEAEIKEAWNLFRLEDVEGYEGEKEGVLRTSNVQHVMRAQGLAPKNEADMREFIETLDPESEGYVTYPHLLALCAIQLKSKTDETKVEEVETAFNLFHPGQGNGGEEPVIRLQDLRAVAKVLKEDVSDDVLRAMILEANGGKGVGSGVNMEDFQAVLTRAGVFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.73
4 0.75
5 0.73
6 0.72
7 0.76
8 0.77
9 0.81
10 0.76
11 0.8
12 0.8
13 0.81
14 0.81
15 0.81
16 0.8
17 0.72
18 0.73
19 0.66
20 0.59
21 0.51
22 0.4
23 0.3
24 0.21
25 0.19
26 0.14
27 0.12
28 0.1
29 0.08
30 0.09
31 0.09
32 0.1
33 0.12
34 0.13
35 0.11
36 0.13
37 0.14
38 0.14
39 0.13
40 0.14
41 0.11
42 0.11
43 0.12
44 0.1
45 0.09
46 0.08
47 0.07
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.1
54 0.13
55 0.15
56 0.19
57 0.19
58 0.18
59 0.19
60 0.2
61 0.19
62 0.16
63 0.14
64 0.15
65 0.17
66 0.18
67 0.17
68 0.15
69 0.15
70 0.17
71 0.17
72 0.13
73 0.12
74 0.13
75 0.13
76 0.13
77 0.12
78 0.12
79 0.12
80 0.11
81 0.1
82 0.08
83 0.07
84 0.07
85 0.07
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.07
101 0.08
102 0.09
103 0.12
104 0.15
105 0.16
106 0.18
107 0.22
108 0.26
109 0.3
110 0.29
111 0.27
112 0.24
113 0.23
114 0.22
115 0.18
116 0.13
117 0.09
118 0.08
119 0.1
120 0.09
121 0.1
122 0.11
123 0.11
124 0.11
125 0.12
126 0.13
127 0.11
128 0.11
129 0.1
130 0.08
131 0.09
132 0.1
133 0.09
134 0.08
135 0.08
136 0.07
137 0.12
138 0.14
139 0.14
140 0.13
141 0.15
142 0.16
143 0.17
144 0.18
145 0.16
146 0.15
147 0.14
148 0.14
149 0.15
150 0.18
151 0.17
152 0.16
153 0.15
154 0.13
155 0.13
156 0.11
157 0.1
158 0.07
159 0.06
160 0.08
161 0.08
162 0.08
163 0.09
164 0.08
165 0.08
166 0.06
167 0.07
168 0.06
169 0.06
170 0.06
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.08
177 0.08
178 0.09
179 0.09
180 0.08
181 0.09