Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9W261

Protein Details
Accession W9W261    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
105-127APVSKKAKAKKTSTPKVAKKAAPHydrophilic
NLS Segment(s)
PositionSequence
77-88AKKATPRKRAAK
109-125KKAKAKKTSTPKVAKKA
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 7.5, pero 3
Family & Domain DBs
Amino Acid Sequences MPMVWNDEADARLFTAVLATTDVKIDWKAVAALMGPECTTKALNHRIAAIKKKAGLLATGGGIASPTPASPATPASAKKATPRKRAAKGAMEAEAEDDENDDNGAPVSKKAKAKKTSTPKVAKKAAPTAADATHSKGCKKVKCESEDEDDGAQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.09
6 0.09
7 0.1
8 0.1
9 0.11
10 0.11
11 0.11
12 0.11
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.08
19 0.09
20 0.09
21 0.09
22 0.08
23 0.08
24 0.09
25 0.09
26 0.1
27 0.09
28 0.16
29 0.23
30 0.27
31 0.27
32 0.31
33 0.36
34 0.4
35 0.46
36 0.44
37 0.38
38 0.36
39 0.37
40 0.34
41 0.28
42 0.24
43 0.18
44 0.14
45 0.12
46 0.1
47 0.09
48 0.07
49 0.06
50 0.05
51 0.04
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.06
58 0.07
59 0.08
60 0.1
61 0.11
62 0.14
63 0.16
64 0.17
65 0.23
66 0.32
67 0.4
68 0.46
69 0.54
70 0.59
71 0.63
72 0.69
73 0.68
74 0.64
75 0.59
76 0.52
77 0.45
78 0.37
79 0.31
80 0.24
81 0.19
82 0.13
83 0.09
84 0.07
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.06
92 0.06
93 0.08
94 0.1
95 0.16
96 0.23
97 0.3
98 0.39
99 0.46
100 0.52
101 0.6
102 0.69
103 0.73
104 0.77
105 0.8
106 0.79
107 0.8
108 0.82
109 0.75
110 0.7
111 0.68
112 0.64
113 0.55
114 0.5
115 0.44
116 0.37
117 0.37
118 0.32
119 0.29
120 0.29
121 0.29
122 0.28
123 0.32
124 0.38
125 0.41
126 0.45
127 0.5
128 0.54
129 0.58
130 0.63
131 0.62
132 0.63
133 0.6
134 0.58