Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VIN0

Protein Details
Accession W9VIN0    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-71ADPSFSRKFEPRRRALHSRSRLIRHydrophilic
418-438EEMEREKREREKQEKEKAAQAAcidic
NLS Segment(s)
PositionSequence
429-429K
Subcellular Location(s) nucl 11, mito 6, plas 6, pero 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MNRHHAFVNGYAANKKRDDDLYHPYNDRGDLENKYIFGMPDLLEDEKADPSFSRKFEPRRRALHSRSRLIRLALFALAVLSLACYFLIPSSSTLSLLSSSSPPASYYDDIETLRYYDLEDVQGTSVGWEREERVLLCTPLRDAAPHLPMFFEHLRNFTYPHHLIDLAFLVSDSKDNTVELLTHLLEEVQNDPDPSQPYGEISVIHKDFGQAVSQDVESRHGFAAQASRRKLMARARNWLLSAALRPYHSWVYWRDADVETCPYTIIEDLMRHDKDIIVPNIWRPLPDWLGGEQPYDLNSWQESETAIALAETLDEDAVIVEGYAEYATWRPHLAYLRDPYGDPDVEMELDGVGGVSILAKARVFRAGVHFPAFSFERHAETEGFGKMAKRMKFSVVGLPHYTVWHLYEPSVDDIRHMEEMEREKREREKQEKEKAAQAKKLEDEFKHVGSQWEKDKEAMMGDGPKENDGSQNPTKDVNNAEMELPAAKEADGAKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.36
4 0.39
5 0.42
6 0.43
7 0.48
8 0.49
9 0.53
10 0.54
11 0.51
12 0.47
13 0.42
14 0.38
15 0.33
16 0.32
17 0.3
18 0.33
19 0.33
20 0.31
21 0.31
22 0.3
23 0.25
24 0.22
25 0.2
26 0.15
27 0.16
28 0.18
29 0.17
30 0.16
31 0.17
32 0.17
33 0.17
34 0.17
35 0.15
36 0.14
37 0.18
38 0.24
39 0.25
40 0.31
41 0.36
42 0.47
43 0.56
44 0.66
45 0.7
46 0.72
47 0.79
48 0.82
49 0.83
50 0.83
51 0.82
52 0.82
53 0.8
54 0.77
55 0.72
56 0.64
57 0.57
58 0.49
59 0.42
60 0.32
61 0.25
62 0.18
63 0.15
64 0.12
65 0.09
66 0.06
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.07
75 0.07
76 0.09
77 0.12
78 0.13
79 0.13
80 0.13
81 0.14
82 0.13
83 0.12
84 0.13
85 0.1
86 0.12
87 0.12
88 0.12
89 0.12
90 0.14
91 0.18
92 0.17
93 0.19
94 0.19
95 0.21
96 0.21
97 0.22
98 0.2
99 0.16
100 0.16
101 0.13
102 0.12
103 0.11
104 0.11
105 0.12
106 0.12
107 0.11
108 0.11
109 0.12
110 0.11
111 0.1
112 0.11
113 0.1
114 0.1
115 0.1
116 0.12
117 0.14
118 0.16
119 0.16
120 0.17
121 0.19
122 0.2
123 0.2
124 0.18
125 0.17
126 0.17
127 0.16
128 0.13
129 0.14
130 0.18
131 0.22
132 0.22
133 0.22
134 0.2
135 0.2
136 0.25
137 0.24
138 0.23
139 0.19
140 0.2
141 0.22
142 0.22
143 0.24
144 0.2
145 0.26
146 0.23
147 0.23
148 0.23
149 0.22
150 0.21
151 0.2
152 0.2
153 0.12
154 0.1
155 0.08
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.08
165 0.08
166 0.08
167 0.09
168 0.08
169 0.08
170 0.07
171 0.07
172 0.07
173 0.08
174 0.08
175 0.08
176 0.09
177 0.09
178 0.1
179 0.12
180 0.14
181 0.14
182 0.13
183 0.12
184 0.12
185 0.13
186 0.13
187 0.12
188 0.11
189 0.16
190 0.15
191 0.15
192 0.14
193 0.13
194 0.14
195 0.13
196 0.13
197 0.08
198 0.08
199 0.09
200 0.09
201 0.1
202 0.1
203 0.13
204 0.11
205 0.13
206 0.12
207 0.11
208 0.11
209 0.1
210 0.18
211 0.19
212 0.25
213 0.25
214 0.26
215 0.26
216 0.27
217 0.31
218 0.32
219 0.36
220 0.34
221 0.4
222 0.42
223 0.43
224 0.42
225 0.37
226 0.3
227 0.22
228 0.19
229 0.13
230 0.12
231 0.11
232 0.11
233 0.13
234 0.14
235 0.13
236 0.15
237 0.15
238 0.19
239 0.2
240 0.2
241 0.2
242 0.19
243 0.2
244 0.18
245 0.19
246 0.14
247 0.13
248 0.12
249 0.09
250 0.09
251 0.08
252 0.08
253 0.06
254 0.06
255 0.08
256 0.14
257 0.14
258 0.14
259 0.14
260 0.14
261 0.16
262 0.21
263 0.21
264 0.17
265 0.17
266 0.18
267 0.23
268 0.22
269 0.2
270 0.15
271 0.17
272 0.17
273 0.18
274 0.18
275 0.14
276 0.18
277 0.18
278 0.17
279 0.13
280 0.12
281 0.12
282 0.11
283 0.1
284 0.08
285 0.08
286 0.09
287 0.09
288 0.09
289 0.08
290 0.08
291 0.08
292 0.07
293 0.07
294 0.05
295 0.04
296 0.04
297 0.04
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.02
307 0.02
308 0.02
309 0.03
310 0.03
311 0.03
312 0.03
313 0.05
314 0.06
315 0.07
316 0.08
317 0.08
318 0.12
319 0.17
320 0.19
321 0.24
322 0.27
323 0.3
324 0.3
325 0.3
326 0.29
327 0.28
328 0.25
329 0.19
330 0.16
331 0.13
332 0.13
333 0.12
334 0.1
335 0.06
336 0.06
337 0.05
338 0.04
339 0.03
340 0.03
341 0.02
342 0.02
343 0.03
344 0.03
345 0.04
346 0.05
347 0.06
348 0.07
349 0.1
350 0.1
351 0.12
352 0.18
353 0.22
354 0.24
355 0.26
356 0.25
357 0.22
358 0.26
359 0.25
360 0.19
361 0.19
362 0.18
363 0.19
364 0.2
365 0.22
366 0.19
367 0.19
368 0.21
369 0.17
370 0.17
371 0.14
372 0.14
373 0.17
374 0.23
375 0.25
376 0.26
377 0.27
378 0.3
379 0.33
380 0.34
381 0.38
382 0.35
383 0.37
384 0.35
385 0.35
386 0.32
387 0.29
388 0.27
389 0.2
390 0.18
391 0.17
392 0.16
393 0.14
394 0.15
395 0.17
396 0.21
397 0.23
398 0.2
399 0.18
400 0.19
401 0.22
402 0.21
403 0.19
404 0.16
405 0.18
406 0.26
407 0.32
408 0.37
409 0.36
410 0.39
411 0.47
412 0.55
413 0.6
414 0.62
415 0.66
416 0.71
417 0.8
418 0.85
419 0.8
420 0.8
421 0.79
422 0.76
423 0.72
424 0.66
425 0.61
426 0.57
427 0.6
428 0.58
429 0.49
430 0.5
431 0.47
432 0.45
433 0.42
434 0.38
435 0.38
436 0.35
437 0.4
438 0.4
439 0.42
440 0.41
441 0.39
442 0.4
443 0.34
444 0.32
445 0.28
446 0.22
447 0.21
448 0.22
449 0.26
450 0.25
451 0.24
452 0.24
453 0.23
454 0.26
455 0.24
456 0.3
457 0.32
458 0.36
459 0.37
460 0.4
461 0.4
462 0.39
463 0.39
464 0.37
465 0.34
466 0.31
467 0.3
468 0.26
469 0.26
470 0.23
471 0.2
472 0.15
473 0.11
474 0.09
475 0.11
476 0.14