Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9W7B2

Protein Details
Accession W9W7B2    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-114YRSLEDRWSKRARKICKRLERBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.833, cyto_mito 10.332, mito 9.5, cyto 9.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007242  Atg12  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0000045  P:autophagosome assembly  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF04110  APG12  
CDD cd01612  Ubl_ATG12  
Amino Acid Sequences MTASVMLTNLPKDASQALREIEAIDDRKVSVRFQAIGSAPILKQKVFKISASSRFSVVLNFLRKKVGVREGDGLFCYVNSVFAPGLDEGVGNLYRSLEDRWSKRARKICKRLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.2
5 0.2
6 0.2
7 0.19
8 0.16
9 0.18
10 0.18
11 0.16
12 0.16
13 0.15
14 0.19
15 0.19
16 0.19
17 0.17
18 0.18
19 0.19
20 0.19
21 0.23
22 0.19
23 0.19
24 0.19
25 0.17
26 0.15
27 0.17
28 0.18
29 0.14
30 0.16
31 0.16
32 0.22
33 0.22
34 0.22
35 0.24
36 0.29
37 0.37
38 0.38
39 0.37
40 0.32
41 0.31
42 0.3
43 0.24
44 0.21
45 0.18
46 0.2
47 0.21
48 0.21
49 0.21
50 0.21
51 0.22
52 0.24
53 0.26
54 0.22
55 0.24
56 0.28
57 0.28
58 0.29
59 0.28
60 0.24
61 0.17
62 0.14
63 0.13
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.09
71 0.08
72 0.08
73 0.07
74 0.07
75 0.06
76 0.09
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.1
83 0.12
84 0.17
85 0.24
86 0.27
87 0.36
88 0.46
89 0.51
90 0.58
91 0.66
92 0.69
93 0.73
94 0.8