Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VG28

Protein Details
Accession W9VG28   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
5-30TTSSSKKSSISPKPRHPPPPNWAPKHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
Amino Acid Sequences MPSATTSSSKKSSISPKPRHPPPPNWAPKHDAFVREKARHGEDPESIRILFEVEFPGVNASKAWIGERMKGSKVEMGIDEKGVGMAIVAHWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.67
4 0.76
5 0.83
6 0.87
7 0.85
8 0.83
9 0.8
10 0.81
11 0.81
12 0.76
13 0.71
14 0.66
15 0.6
16 0.58
17 0.53
18 0.48
19 0.41
20 0.44
21 0.48
22 0.44
23 0.45
24 0.42
25 0.43
26 0.4
27 0.39
28 0.34
29 0.29
30 0.3
31 0.29
32 0.27
33 0.22
34 0.19
35 0.16
36 0.14
37 0.1
38 0.07
39 0.07
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.13
52 0.14
53 0.2
54 0.25
55 0.27
56 0.28
57 0.29
58 0.3
59 0.27
60 0.26
61 0.23
62 0.2
63 0.21
64 0.2
65 0.2
66 0.18
67 0.15
68 0.14
69 0.12
70 0.1
71 0.05
72 0.05