Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9VYL8

Protein Details
Accession W9VYL8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-41DEAPLRRSSRRKTAARASDGHydrophilic
404-423LPRAEEGSRNRNPKRRKVKKBasic
NLS Segment(s)
PositionSequence
411-423SRNRNPKRRKVKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR046879  KANL3/Tex30_Abhydrolase  
IPR026555  NSL3/Tex30  
Pfam View protein in Pfam  
PF20408  Abhydrolase_11  
Amino Acid Sequences MAPRKRKAAATAADNADSHVDDEAPLRRSSRRKTAARASDGQGEETTAQASGKQRIEKTSHASDKRGKKSTTQASDERGKDTATAANSQGENKQPRSTGPAQNQNHEAQDTSKIALDAQPHAEPDNATISDHPTRPFTQFTIDIPASKKGGKAISCLRSPSTPQHPRCLIFTHGAGGDLSAAAMVHFSAGFASRGEDATAGLIMFPGTMNVKARAAMFDLVKQHGLGQGDREGVNFAYGGRSMGARAAVMASHVDEDVKMLVLVSYPLVSPAGDVRDKILLEIRPDVDVLFISGDQDSMCDLDMLDKVRGKMKARSWLVRVRGADHGMNLRGGKKLKEGTEAVGATTGKVAAVWIKERDAEKREMELSWDGEGEHGDVVSSGWLAGGRNGQGEEKSKDVVEEELPRAEEGSRNRNPKRRKVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.34
4 0.28
5 0.22
6 0.15
7 0.11
8 0.1
9 0.14
10 0.18
11 0.2
12 0.21
13 0.23
14 0.3
15 0.38
16 0.46
17 0.53
18 0.58
19 0.62
20 0.7
21 0.78
22 0.8
23 0.79
24 0.77
25 0.7
26 0.68
27 0.61
28 0.54
29 0.44
30 0.36
31 0.29
32 0.23
33 0.2
34 0.11
35 0.11
36 0.12
37 0.16
38 0.22
39 0.26
40 0.32
41 0.34
42 0.4
43 0.44
44 0.46
45 0.49
46 0.52
47 0.57
48 0.55
49 0.59
50 0.62
51 0.68
52 0.71
53 0.72
54 0.64
55 0.61
56 0.67
57 0.7
58 0.7
59 0.66
60 0.62
61 0.6
62 0.67
63 0.62
64 0.55
65 0.45
66 0.37
67 0.31
68 0.28
69 0.26
70 0.19
71 0.2
72 0.18
73 0.21
74 0.22
75 0.23
76 0.24
77 0.28
78 0.32
79 0.32
80 0.35
81 0.32
82 0.32
83 0.39
84 0.43
85 0.44
86 0.47
87 0.54
88 0.53
89 0.57
90 0.59
91 0.53
92 0.47
93 0.39
94 0.31
95 0.23
96 0.25
97 0.22
98 0.18
99 0.17
100 0.16
101 0.15
102 0.17
103 0.18
104 0.15
105 0.17
106 0.17
107 0.17
108 0.18
109 0.18
110 0.16
111 0.15
112 0.17
113 0.14
114 0.13
115 0.13
116 0.17
117 0.21
118 0.22
119 0.22
120 0.21
121 0.23
122 0.25
123 0.27
124 0.23
125 0.23
126 0.23
127 0.23
128 0.26
129 0.24
130 0.25
131 0.25
132 0.26
133 0.23
134 0.22
135 0.22
136 0.18
137 0.22
138 0.21
139 0.23
140 0.29
141 0.33
142 0.34
143 0.35
144 0.33
145 0.3
146 0.32
147 0.34
148 0.37
149 0.41
150 0.42
151 0.48
152 0.5
153 0.49
154 0.48
155 0.45
156 0.37
157 0.29
158 0.27
159 0.21
160 0.18
161 0.17
162 0.14
163 0.11
164 0.08
165 0.06
166 0.05
167 0.03
168 0.03
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.03
176 0.04
177 0.04
178 0.04
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06
187 0.04
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.05
196 0.06
197 0.07
198 0.08
199 0.09
200 0.09
201 0.09
202 0.1
203 0.11
204 0.1
205 0.12
206 0.13
207 0.13
208 0.13
209 0.13
210 0.12
211 0.12
212 0.13
213 0.11
214 0.1
215 0.11
216 0.13
217 0.13
218 0.12
219 0.11
220 0.1
221 0.1
222 0.08
223 0.06
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.05
230 0.06
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.04
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.05
255 0.05
256 0.05
257 0.05
258 0.07
259 0.1
260 0.1
261 0.11
262 0.12
263 0.14
264 0.14
265 0.15
266 0.17
267 0.16
268 0.17
269 0.2
270 0.19
271 0.17
272 0.17
273 0.17
274 0.12
275 0.1
276 0.09
277 0.07
278 0.06
279 0.06
280 0.06
281 0.06
282 0.05
283 0.06
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.06
290 0.09
291 0.11
292 0.13
293 0.15
294 0.16
295 0.21
296 0.26
297 0.28
298 0.33
299 0.37
300 0.44
301 0.48
302 0.53
303 0.53
304 0.56
305 0.57
306 0.56
307 0.51
308 0.44
309 0.43
310 0.4
311 0.35
312 0.3
313 0.3
314 0.25
315 0.26
316 0.24
317 0.21
318 0.23
319 0.24
320 0.23
321 0.26
322 0.3
323 0.3
324 0.34
325 0.34
326 0.32
327 0.37
328 0.35
329 0.29
330 0.27
331 0.25
332 0.19
333 0.18
334 0.15
335 0.08
336 0.08
337 0.08
338 0.08
339 0.11
340 0.15
341 0.16
342 0.17
343 0.22
344 0.24
345 0.31
346 0.33
347 0.36
348 0.34
349 0.36
350 0.37
351 0.33
352 0.35
353 0.31
354 0.28
355 0.23
356 0.21
357 0.17
358 0.16
359 0.16
360 0.13
361 0.09
362 0.07
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.05
369 0.05
370 0.06
371 0.06
372 0.09
373 0.12
374 0.12
375 0.14
376 0.16
377 0.18
378 0.2
379 0.26
380 0.27
381 0.26
382 0.27
383 0.25
384 0.25
385 0.24
386 0.24
387 0.23
388 0.26
389 0.26
390 0.28
391 0.28
392 0.28
393 0.27
394 0.26
395 0.26
396 0.27
397 0.34
398 0.39
399 0.48
400 0.57
401 0.66
402 0.75
403 0.8