FuNGI

C8V4G0

Protein Details

Accession

C8V4G0

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
1-31	MEERIRKRIPKSCRRCHRRKQRCVGAPVCAN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 15, plas 7, mito 2, cyto 2, cyto_mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR007219 Transcription_factor_dom_fun IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0016020 C:membrane GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0043565 F:sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0045944 P:positive regulation of transcription by RNA polymerase II
Pfam	View protein in Pfam PF04082 Fungal_trans
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1
CDD	cd12148 fungal_TF_MHR cd00067 GAL4

Amino Acid Sequences

MEERIRKRIPKSCRRCHRRKQRCVGAPVCANCELAGQPCVRSDSVPSWHHGMSKGALAQRIETLEAQLAALTERQTRSASVSRSEEHRQYPDDTRSSGEGLRPSTGSGSGSGSNASISTITDSPETQGAVMHFFIQGPGRYEDKVEGNYLGPSSGLAIAENISRIVQDAVWKSIPVNETHEFQAPCENETTGPASAPDDAMGARILEAYFKSMQMRLPFLCRAEIYELHARRYEPVGPSTAEQFARFKIFMVYAIGAAILRMTEMYDSTPPRNYFVTAMQYQPAIQGSLSISSIEALMLLAMYNLQSSASSSVWYMMGLATRICVDFGLHREVQYRRLSPYEAQRRRRLFWSVYLNERSVAWSLGRPFSIGDEEIDAEPPADIDDSLPESADEDSFRTPRDRGELWTGPNIRCFIACIKLSRISSKIRSTVYRLDRDLPSLLHKVYPLLARLDEYQKSLPYLSAYENDFIQMHWNNATRTLLHPFLSILPPDDELARRCLYSSGQMCQYFKRLRQRDSTWYSFLLINTLFMAGLTICLCLFRSPRLWTISVSNDLRACSSALFVMAERHPSVRKYRDALETAINRVMDYVSDAQIQSQTHTTGSMSYTLDRALTDPPTPGFYIPSPQASRASAPGLGVEETSETIPIPLSDGRATTFSGLFTEDFWAGDAFSLHMGETFGLRT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.89
2	0.92
3	0.94
4	0.95
5	0.95
6	0.95
7	0.95
8	0.95
9	0.94
10	0.92
11	0.86
12	0.83
13	0.8
14	0.72
15	0.65
16	0.55
17	0.46
18	0.36
19	0.33
20	0.26
21	0.21
22	0.22
23	0.18
24	0.18
25	0.2
26	0.23
27	0.22
28	0.21
29	0.23
30	0.26
31	0.33
32	0.34
33	0.35
34	0.37
35	0.37
36	0.39
37	0.36
38	0.32
39	0.26
40	0.28
41	0.29
42	0.28
43	0.3
44	0.28
45	0.27
46	0.27
47	0.26
48	0.24
49	0.2
50	0.19
51	0.16
52	0.16
53	0.15
54	0.12
55	0.11
56	0.1
57	0.11
58	0.11
59	0.14
60	0.15
61	0.17
62	0.18
63	0.19
64	0.24
65	0.29
66	0.31
67	0.32
68	0.35
69	0.36
70	0.41
71	0.47
72	0.47
73	0.45
74	0.47
75	0.45
76	0.45
77	0.5
78	0.51
79	0.48
80	0.43
81	0.41
82	0.38
83	0.37
84	0.34
85	0.31
86	0.27
87	0.26
88	0.27
89	0.24
90	0.23
91	0.22
92	0.21
93	0.18
94	0.14
95	0.15
96	0.14
97	0.14
98	0.14
99	0.13
100	0.12
101	0.11
102	0.1
103	0.07
104	0.07
105	0.1
106	0.1
107	0.11
108	0.12
109	0.12
110	0.13
111	0.14
112	0.14
113	0.11
114	0.12
115	0.11
116	0.12
117	0.12
118	0.12
119	0.11
120	0.1
121	0.12
122	0.13
123	0.14
124	0.16
125	0.18
126	0.19
127	0.2
128	0.21
129	0.23
130	0.23
131	0.23
132	0.21
133	0.19
134	0.18
135	0.19
136	0.18
137	0.15
138	0.11
139	0.09
140	0.09
141	0.08
142	0.07
143	0.06
144	0.07
145	0.07
146	0.08
147	0.08
148	0.07
149	0.06
150	0.06
151	0.07
152	0.07
153	0.07
154	0.12
155	0.14
156	0.17
157	0.18
158	0.18
159	0.18
160	0.21
161	0.22
162	0.18
163	0.22
164	0.21
165	0.23
166	0.25
167	0.3
168	0.26
169	0.25
170	0.3
171	0.25
172	0.24
173	0.23
174	0.22
175	0.16
176	0.18
177	0.2
178	0.13
179	0.13
180	0.12
181	0.11
182	0.11
183	0.11
184	0.09
185	0.07
186	0.07
187	0.07
188	0.07
189	0.06
190	0.05
191	0.06
192	0.06
193	0.06
194	0.06
195	0.09
196	0.09
197	0.1
198	0.12
199	0.13
200	0.16
201	0.17
202	0.21
203	0.19
204	0.22
205	0.24
206	0.23
207	0.24
208	0.21
209	0.21
210	0.21
211	0.21
212	0.22
213	0.28
214	0.28
215	0.29
216	0.31
217	0.28
218	0.26
219	0.28
220	0.27
221	0.21
222	0.21
223	0.22
224	0.2
225	0.21
226	0.21
227	0.22
228	0.19
229	0.18
230	0.17
231	0.16
232	0.18
233	0.17
234	0.15
235	0.13
236	0.13
237	0.12
238	0.13
239	0.12
240	0.09
241	0.09
242	0.09
243	0.07
244	0.06
245	0.05
246	0.03
247	0.03
248	0.02
249	0.03
250	0.03
251	0.03
252	0.05
253	0.09
254	0.11
255	0.13
256	0.19
257	0.19
258	0.21
259	0.21
260	0.21
261	0.19
262	0.2
263	0.24
264	0.2
265	0.2
266	0.19
267	0.18
268	0.17
269	0.16
270	0.14
271	0.09
272	0.07
273	0.07
274	0.07
275	0.08
276	0.08
277	0.07
278	0.06
279	0.06
280	0.06
281	0.05
282	0.04
283	0.03
284	0.03
285	0.03
286	0.03
287	0.02
288	0.02
289	0.02
290	0.02
291	0.02
292	0.03
293	0.03
294	0.04
295	0.06
296	0.06
297	0.06
298	0.07
299	0.07
300	0.07
301	0.07
302	0.07
303	0.05
304	0.05
305	0.05
306	0.05
307	0.05
308	0.05
309	0.05
310	0.05
311	0.05
312	0.05
313	0.06
314	0.09
315	0.13
316	0.13
317	0.14
318	0.18
319	0.19
320	0.25
321	0.27
322	0.26
323	0.23
324	0.24
325	0.26
326	0.24
327	0.33
328	0.39
329	0.43
330	0.48
331	0.54
332	0.57
333	0.57
334	0.58
335	0.53
336	0.43
337	0.42
338	0.45
339	0.39
340	0.41
341	0.41
342	0.38
343	0.33
344	0.31
345	0.25
346	0.17
347	0.15
348	0.1
349	0.1
350	0.11
351	0.12
352	0.12
353	0.11
354	0.1
355	0.11
356	0.12
357	0.1
358	0.08
359	0.08
360	0.09
361	0.09
362	0.09
363	0.08
364	0.07
365	0.06
366	0.06
367	0.05
368	0.04
369	0.04
370	0.03
371	0.04
372	0.06
373	0.06
374	0.06
375	0.06
376	0.06
377	0.07
378	0.07
379	0.07
380	0.07
381	0.09
382	0.09
383	0.11
384	0.12
385	0.12
386	0.13
387	0.18
388	0.17
389	0.19
390	0.26
391	0.28
392	0.28
393	0.35
394	0.37
395	0.32
396	0.34
397	0.32
398	0.24
399	0.2
400	0.2
401	0.15
402	0.17
403	0.18
404	0.18
405	0.2
406	0.25
407	0.26
408	0.27
409	0.28
410	0.28
411	0.32
412	0.34
413	0.35
414	0.33
415	0.35
416	0.37
417	0.43
418	0.44
419	0.44
420	0.42
421	0.42
422	0.4
423	0.4
424	0.36
425	0.28
426	0.26
427	0.23
428	0.22
429	0.18
430	0.17
431	0.16
432	0.17
433	0.18
434	0.15
435	0.14
436	0.14
437	0.14
438	0.17
439	0.21
440	0.19
441	0.2
442	0.2
443	0.19
444	0.2
445	0.19
446	0.17
447	0.13
448	0.14
449	0.13
450	0.15
451	0.15
452	0.15
453	0.15
454	0.15
455	0.14
456	0.12
457	0.16
458	0.14
459	0.14
460	0.16
461	0.19
462	0.18
463	0.2
464	0.21
465	0.17
466	0.18
467	0.22
468	0.2
469	0.18
470	0.18
471	0.17
472	0.19
473	0.19
474	0.17
475	0.15
476	0.14
477	0.14
478	0.14
479	0.15
480	0.15
481	0.15
482	0.18
483	0.17
484	0.16
485	0.16
486	0.17
487	0.16
488	0.22
489	0.24
490	0.23
491	0.29
492	0.32
493	0.33
494	0.33
495	0.4
496	0.38
497	0.41
498	0.48
499	0.49
500	0.51
501	0.59
502	0.63
503	0.65
504	0.68
505	0.66
506	0.58
507	0.52
508	0.49
509	0.42
510	0.36
511	0.29
512	0.21
513	0.16
514	0.13
515	0.12
516	0.1
517	0.08
518	0.08
519	0.05
520	0.06
521	0.06
522	0.06
523	0.05
524	0.06
525	0.07
526	0.09
527	0.11
528	0.13
529	0.18
530	0.21
531	0.27
532	0.31
533	0.32
534	0.31
535	0.34
536	0.35
537	0.38
538	0.35
539	0.33
540	0.31
541	0.3
542	0.29
543	0.25
544	0.21
545	0.14
546	0.13
547	0.1
548	0.09
549	0.1
550	0.09
551	0.13
552	0.13
553	0.16
554	0.17
555	0.19
556	0.21
557	0.25
558	0.33
559	0.35
560	0.4
561	0.41
562	0.45
563	0.5
564	0.5
565	0.49
566	0.49
567	0.45
568	0.43
569	0.42
570	0.36
571	0.28
572	0.26
573	0.23
574	0.15
575	0.16
576	0.15
577	0.13
578	0.15
579	0.15
580	0.16
581	0.19
582	0.19
583	0.17
584	0.17
585	0.17
586	0.15
587	0.16
588	0.15
589	0.14
590	0.15
591	0.16
592	0.15
593	0.15
594	0.16
595	0.15
596	0.16
597	0.14
598	0.14
599	0.14
600	0.16
601	0.16
602	0.18
603	0.18
604	0.21
605	0.22
606	0.21
607	0.21
608	0.19
609	0.24
610	0.25
611	0.31
612	0.31
613	0.32
614	0.35
615	0.34
616	0.35
617	0.31
618	0.31
619	0.24
620	0.22
621	0.21
622	0.2
623	0.18
624	0.15
625	0.13
626	0.11
627	0.11
628	0.12
629	0.1
630	0.09
631	0.08
632	0.09
633	0.08
634	0.11
635	0.11
636	0.13
637	0.14
638	0.15
639	0.17
640	0.18
641	0.19
642	0.18
643	0.17
644	0.15
645	0.15
646	0.16
647	0.14
648	0.14
649	0.16
650	0.14
651	0.13
652	0.14
653	0.13
654	0.11
655	0.12
656	0.11
657	0.09
658	0.09
659	0.09
660	0.08
661	0.09
662	0.09
663	0.09

C8V4G0

3D AlphaFold-predicted Structure Viewer