Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VE94

Protein Details
Accession W9VE94   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-37WRISSMQKARQRKRLRAVDKHydrophilic
74-103DKYTIFDRKEKKYRKGIHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
PositionSequence
82-95KEKKYRKGIHKLPK
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFRPTAPLSGGLLWKIPWRISSMQKARQRKRLRAVDKVVDTVSMALQKNGCVTAKAVERWYQEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.17
5 0.21
6 0.25
7 0.31
8 0.4
9 0.45
10 0.52
11 0.6
12 0.69
13 0.72
14 0.77
15 0.8
16 0.78
17 0.8
18 0.81
19 0.79
20 0.78
21 0.77
22 0.74
23 0.67
24 0.6
25 0.49
26 0.39
27 0.32
28 0.23
29 0.17
30 0.14
31 0.12
32 0.11
33 0.11
34 0.11
35 0.11
36 0.12
37 0.12
38 0.08
39 0.08
40 0.11
41 0.13
42 0.14
43 0.15
44 0.18
45 0.19
46 0.21
47 0.23
48 0.22
49 0.24
50 0.27
51 0.29
52 0.27
53 0.28
54 0.25
55 0.27
56 0.27
57 0.3
58 0.26
59 0.23
60 0.22
61 0.21
62 0.24
63 0.26
64 0.32
65 0.3
66 0.39
67 0.45
68 0.54
69 0.63
70 0.68
71 0.71
72 0.72
73 0.79
74 0.8
75 0.85
76 0.85
77 0.86
78 0.86
79 0.89
80 0.88
81 0.88
82 0.83
83 0.8
84 0.8
85 0.8
86 0.8
87 0.77
88 0.79