Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9W875

Protein Details
Accession W9W875    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGTGNQQRRRNNLKQSRRWQSTDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000206  Ribosomal_L7/12  
IPR014719  Ribosomal_L7/12_C/ClpS-like  
IPR013823  Ribosomal_L7/L12_C  
IPR008932  Ribosomal_L7/L12_oligo  
IPR036235  Ribosomal_L7/L12_oligo_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00542  Ribosomal_L12  
PF16320  Ribosomal_L12_N  
CDD cd00387  Ribosomal_L7_L12  
Amino Acid Sequences MGTGNQQRRRNNLKQSRRWQSTDASAALTNPKIAGIVDQISQLTLLETADLVASLKSRLNIPDMAFAAPAAASGAGAAAAPAAEAEPEEAAPAPAEKTMFTLKLESFDAAAKPKVIKEVKGLLGLSLVDSKKFVESAPKQMKEGVPKEDAEKIVAAMKALGAVVSMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.89
4 0.87
5 0.82
6 0.75
7 0.69
8 0.65
9 0.6
10 0.5
11 0.41
12 0.35
13 0.31
14 0.31
15 0.26
16 0.19
17 0.14
18 0.13
19 0.1
20 0.1
21 0.1
22 0.09
23 0.1
24 0.1
25 0.11
26 0.11
27 0.1
28 0.1
29 0.09
30 0.07
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.07
44 0.08
45 0.1
46 0.12
47 0.15
48 0.15
49 0.18
50 0.18
51 0.18
52 0.16
53 0.15
54 0.13
55 0.1
56 0.08
57 0.04
58 0.03
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.07
85 0.09
86 0.1
87 0.1
88 0.12
89 0.12
90 0.14
91 0.15
92 0.13
93 0.12
94 0.12
95 0.13
96 0.13
97 0.13
98 0.12
99 0.12
100 0.13
101 0.2
102 0.21
103 0.21
104 0.23
105 0.29
106 0.3
107 0.32
108 0.31
109 0.23
110 0.22
111 0.2
112 0.17
113 0.15
114 0.14
115 0.11
116 0.12
117 0.12
118 0.12
119 0.13
120 0.12
121 0.18
122 0.21
123 0.32
124 0.42
125 0.43
126 0.43
127 0.47
128 0.51
129 0.5
130 0.51
131 0.45
132 0.38
133 0.38
134 0.4
135 0.41
136 0.38
137 0.3
138 0.26
139 0.21
140 0.22
141 0.22
142 0.19
143 0.14
144 0.13
145 0.11
146 0.11
147 0.1