Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WF67

Protein Details
Accession W9WF67   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
249-271ITSGRTAKPPPKRRKYDEYLGTDHydrophilic
NLS Segment(s)
PositionSequence
177-236RVSKAMERRRQEEEKAKASKEKPRGTRPAPGKQQVKSRSVSPAKRTDQPRVPKAPRPPLH
253-263RTAKPPPKRRK
331-350KREKEEKRKRLMALADKRRK
Subcellular Location(s) nucl 21, cyto_nucl 13.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSLFSDIVNSIGGDKSPAPPRLPARPLSANGVRPASDVSKPASRLGVPAVPSPLNGVKRKAEDGPPKLPEKLIKPNPNSTTTNRITHRPAAPPLNAPKAANEKSEKNLAAPRPKLNTTTDLPARAAVVSTASPTTAAKGPAKGSYAELMARAKQAQTEKAQQSQVGMIKHQPTHRERVSKAMERRRQEEEKAKASKEKPRGTRPAPGKQQVKSRSVSPAKRTDQPRVPKAPRPPLHAPPSSSYKGTMGITSGRTAKPPPKRRKYDEYLGTDEEDESDDMGGYGEGEEDDYGSDASSDMEAGLDDLDAEEQRALKAAKEEDARELALENQLKREKEEKRKRLMALADKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.18
3 0.25
4 0.3
5 0.31
6 0.37
7 0.43
8 0.5
9 0.54
10 0.52
11 0.51
12 0.53
13 0.54
14 0.55
15 0.55
16 0.5
17 0.49
18 0.47
19 0.4
20 0.34
21 0.35
22 0.3
23 0.26
24 0.24
25 0.25
26 0.28
27 0.3
28 0.31
29 0.3
30 0.27
31 0.26
32 0.28
33 0.28
34 0.24
35 0.25
36 0.27
37 0.24
38 0.24
39 0.26
40 0.28
41 0.31
42 0.32
43 0.34
44 0.35
45 0.39
46 0.42
47 0.43
48 0.46
49 0.49
50 0.53
51 0.56
52 0.56
53 0.56
54 0.54
55 0.51
56 0.47
57 0.44
58 0.48
59 0.5
60 0.54
61 0.56
62 0.64
63 0.65
64 0.66
65 0.63
66 0.57
67 0.56
68 0.51
69 0.53
70 0.47
71 0.47
72 0.47
73 0.49
74 0.5
75 0.46
76 0.47
77 0.45
78 0.45
79 0.47
80 0.47
81 0.47
82 0.44
83 0.38
84 0.37
85 0.4
86 0.4
87 0.38
88 0.37
89 0.33
90 0.35
91 0.4
92 0.36
93 0.31
94 0.35
95 0.36
96 0.41
97 0.41
98 0.43
99 0.43
100 0.44
101 0.44
102 0.41
103 0.39
104 0.33
105 0.36
106 0.34
107 0.3
108 0.29
109 0.26
110 0.24
111 0.19
112 0.16
113 0.09
114 0.08
115 0.06
116 0.07
117 0.07
118 0.06
119 0.07
120 0.06
121 0.09
122 0.1
123 0.13
124 0.13
125 0.15
126 0.16
127 0.18
128 0.19
129 0.18
130 0.16
131 0.15
132 0.14
133 0.12
134 0.13
135 0.12
136 0.11
137 0.12
138 0.11
139 0.1
140 0.13
141 0.14
142 0.17
143 0.19
144 0.27
145 0.28
146 0.32
147 0.33
148 0.29
149 0.28
150 0.27
151 0.27
152 0.19
153 0.18
154 0.17
155 0.19
156 0.22
157 0.23
158 0.27
159 0.26
160 0.33
161 0.37
162 0.39
163 0.36
164 0.42
165 0.46
166 0.46
167 0.52
168 0.54
169 0.56
170 0.55
171 0.58
172 0.57
173 0.54
174 0.52
175 0.53
176 0.5
177 0.51
178 0.52
179 0.49
180 0.49
181 0.5
182 0.52
183 0.52
184 0.54
185 0.53
186 0.58
187 0.65
188 0.61
189 0.65
190 0.65
191 0.65
192 0.65
193 0.66
194 0.63
195 0.58
196 0.64
197 0.62
198 0.59
199 0.51
200 0.45
201 0.47
202 0.49
203 0.51
204 0.48
205 0.52
206 0.51
207 0.57
208 0.59
209 0.58
210 0.58
211 0.61
212 0.63
213 0.63
214 0.65
215 0.64
216 0.69
217 0.72
218 0.67
219 0.67
220 0.66
221 0.64
222 0.67
223 0.63
224 0.57
225 0.5
226 0.53
227 0.47
228 0.41
229 0.34
230 0.27
231 0.26
232 0.24
233 0.2
234 0.14
235 0.15
236 0.16
237 0.17
238 0.19
239 0.17
240 0.18
241 0.22
242 0.29
243 0.36
244 0.46
245 0.55
246 0.62
247 0.71
248 0.78
249 0.84
250 0.84
251 0.83
252 0.82
253 0.77
254 0.72
255 0.64
256 0.57
257 0.48
258 0.4
259 0.3
260 0.22
261 0.15
262 0.1
263 0.09
264 0.07
265 0.07
266 0.07
267 0.06
268 0.05
269 0.04
270 0.04
271 0.04
272 0.05
273 0.05
274 0.04
275 0.05
276 0.05
277 0.05
278 0.05
279 0.05
280 0.05
281 0.06
282 0.06
283 0.05
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.04
290 0.04
291 0.04
292 0.05
293 0.05
294 0.06
295 0.07
296 0.08
297 0.08
298 0.12
299 0.12
300 0.13
301 0.18
302 0.19
303 0.25
304 0.29
305 0.31
306 0.31
307 0.34
308 0.32
309 0.27
310 0.26
311 0.21
312 0.24
313 0.27
314 0.24
315 0.3
316 0.35
317 0.36
318 0.4
319 0.47
320 0.5
321 0.56
322 0.67
323 0.68
324 0.73
325 0.8
326 0.78
327 0.77
328 0.77
329 0.76
330 0.76