Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9W4F3

Protein Details
Accession W9W4F3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-37QEYNKRRATWKESEKKRKEEVKLBasic
NLS Segment(s)
PositionSequence
24-32WKESEKKRK
Subcellular Location(s) nucl 14.5, mito_nucl 8.5, cyto 7, pero 3
Family & Domain DBs
Amino Acid Sequences MSVSGFSVQHDFEVQEYNKRRATWKESEKKRKEEVKLLRVQAKAIREAALQQLKVLGVGEQKNMRAAFGWIRTSRREKSEKGPTSRLTEGKLLEDDSDGDSDEITLTDALAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.31
4 0.35
5 0.38
6 0.39
7 0.43
8 0.43
9 0.5
10 0.52
11 0.57
12 0.63
13 0.7
14 0.8
15 0.83
16 0.82
17 0.83
18 0.81
19 0.76
20 0.75
21 0.74
22 0.72
23 0.71
24 0.69
25 0.66
26 0.57
27 0.54
28 0.47
29 0.39
30 0.32
31 0.26
32 0.22
33 0.16
34 0.17
35 0.21
36 0.2
37 0.18
38 0.16
39 0.15
40 0.14
41 0.14
42 0.13
43 0.08
44 0.08
45 0.09
46 0.11
47 0.12
48 0.12
49 0.15
50 0.15
51 0.14
52 0.11
53 0.12
54 0.14
55 0.15
56 0.2
57 0.2
58 0.22
59 0.27
60 0.33
61 0.35
62 0.39
63 0.42
64 0.41
65 0.47
66 0.56
67 0.6
68 0.6
69 0.64
70 0.6
71 0.61
72 0.62
73 0.55
74 0.47
75 0.43
76 0.37
77 0.33
78 0.31
79 0.25
80 0.2
81 0.19
82 0.17
83 0.15
84 0.14
85 0.12
86 0.11
87 0.1
88 0.09
89 0.09
90 0.08
91 0.07
92 0.07