Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VY20

Protein Details
Accession W9VY20   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-119DPILQVRPTRRPARPRRRPGNGSMDLHydrophilic
NLS Segment(s)
PositionSequence
102-112TRRPARPRRRP
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MDTRVDTLSGRFGGQWAFLSSPPTAGSRSVPHSSSYLRSDRSNISPLPTALHFHQLNASRSSLPRHAHAASVGDRSSTTTIPTHPVLVRVHSADPILQVRPTRRPARPRRRPGNGSMDLPAEEEFSIRGILAAIAEDIEDDVDAIAEILGRSRLVLADQHESHMPPQGEIRAISSSLQAVAEASASNERLAAASDDVLILQEDASLVEGSHTGSAAYGLLERLQIVPASRRMRSEIPRTAGSRPATASVRHYSAPPTLPVVPAAAEDMGVSTNTSLPQSSRRLLQSHMEGDKLQDAQPRTTDAVVAETYLSAAANAVTVSDPPVVSEAGRHYPLYSYDYSELFEGPINSPPPVRMTLRERLQSFIPHIDLPNLVSWVHGHDTQVISAESQLREILHRQRPVRGPSSNQGETVESPEMYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.17
5 0.17
6 0.2
7 0.19
8 0.19
9 0.19
10 0.18
11 0.17
12 0.17
13 0.2
14 0.22
15 0.28
16 0.31
17 0.31
18 0.31
19 0.33
20 0.35
21 0.36
22 0.38
23 0.38
24 0.37
25 0.38
26 0.41
27 0.43
28 0.44
29 0.45
30 0.4
31 0.38
32 0.39
33 0.37
34 0.35
35 0.31
36 0.3
37 0.25
38 0.32
39 0.28
40 0.25
41 0.31
42 0.34
43 0.37
44 0.36
45 0.36
46 0.31
47 0.33
48 0.38
49 0.38
50 0.33
51 0.33
52 0.36
53 0.34
54 0.32
55 0.32
56 0.31
57 0.27
58 0.29
59 0.26
60 0.21
61 0.2
62 0.21
63 0.22
64 0.18
65 0.17
66 0.15
67 0.17
68 0.21
69 0.22
70 0.23
71 0.21
72 0.26
73 0.25
74 0.26
75 0.27
76 0.25
77 0.25
78 0.22
79 0.22
80 0.18
81 0.19
82 0.19
83 0.17
84 0.17
85 0.2
86 0.23
87 0.3
88 0.38
89 0.43
90 0.48
91 0.58
92 0.67
93 0.75
94 0.82
95 0.85
96 0.87
97 0.89
98 0.87
99 0.84
100 0.83
101 0.76
102 0.67
103 0.58
104 0.49
105 0.39
106 0.34
107 0.27
108 0.17
109 0.12
110 0.1
111 0.08
112 0.07
113 0.07
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.08
143 0.1
144 0.16
145 0.16
146 0.17
147 0.18
148 0.19
149 0.18
150 0.22
151 0.19
152 0.13
153 0.15
154 0.15
155 0.15
156 0.15
157 0.16
158 0.11
159 0.11
160 0.12
161 0.11
162 0.09
163 0.09
164 0.08
165 0.06
166 0.05
167 0.05
168 0.05
169 0.04
170 0.05
171 0.05
172 0.06
173 0.06
174 0.06
175 0.06
176 0.05
177 0.06
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.03
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.03
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.06
212 0.06
213 0.09
214 0.15
215 0.19
216 0.19
217 0.2
218 0.23
219 0.29
220 0.34
221 0.4
222 0.39
223 0.4
224 0.43
225 0.44
226 0.42
227 0.42
228 0.37
229 0.31
230 0.25
231 0.25
232 0.23
233 0.22
234 0.24
235 0.21
236 0.22
237 0.21
238 0.21
239 0.19
240 0.21
241 0.21
242 0.18
243 0.18
244 0.17
245 0.17
246 0.16
247 0.14
248 0.11
249 0.1
250 0.1
251 0.07
252 0.06
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.04
259 0.05
260 0.06
261 0.06
262 0.06
263 0.07
264 0.13
265 0.18
266 0.19
267 0.23
268 0.25
269 0.27
270 0.29
271 0.32
272 0.32
273 0.33
274 0.33
275 0.3
276 0.27
277 0.26
278 0.27
279 0.23
280 0.2
281 0.19
282 0.2
283 0.2
284 0.21
285 0.23
286 0.22
287 0.2
288 0.19
289 0.15
290 0.16
291 0.14
292 0.13
293 0.1
294 0.08
295 0.08
296 0.07
297 0.07
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.07
307 0.08
308 0.08
309 0.08
310 0.09
311 0.09
312 0.09
313 0.11
314 0.13
315 0.17
316 0.19
317 0.19
318 0.18
319 0.19
320 0.22
321 0.24
322 0.21
323 0.21
324 0.21
325 0.22
326 0.22
327 0.21
328 0.19
329 0.15
330 0.16
331 0.13
332 0.13
333 0.17
334 0.18
335 0.18
336 0.18
337 0.19
338 0.2
339 0.23
340 0.24
341 0.26
342 0.31
343 0.39
344 0.46
345 0.52
346 0.5
347 0.48
348 0.48
349 0.46
350 0.44
351 0.39
352 0.35
353 0.3
354 0.29
355 0.29
356 0.26
357 0.23
358 0.22
359 0.18
360 0.15
361 0.14
362 0.13
363 0.15
364 0.18
365 0.17
366 0.16
367 0.19
368 0.21
369 0.21
370 0.22
371 0.19
372 0.16
373 0.18
374 0.22
375 0.18
376 0.17
377 0.18
378 0.17
379 0.19
380 0.25
381 0.33
382 0.36
383 0.44
384 0.46
385 0.53
386 0.61
387 0.65
388 0.67
389 0.63
390 0.62
391 0.63
392 0.7
393 0.63
394 0.56
395 0.5
396 0.46
397 0.41
398 0.39
399 0.33