Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VSY3

Protein Details
Accession W9VSY3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
107-137IVAPPRHKAKEVKRRTKTGCLTCRKRRIKVSHydrophilic
NLS Segment(s)
PositionSequence
112-121RHKAKEVKRR
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MSTAALQSSTSSISLPPISSIDFHAHMAHRSEPEVVQPLPPPPPSQQRVLPPLPYPYAARPGPPPVPPPPMPHEYMQARPMYPGMPSPYQPMPGRMALPSTTDPSLIVAPPRHKAKEVKRRTKTGCLTCRKRRIKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.13
5 0.14
6 0.14
7 0.16
8 0.17
9 0.17
10 0.18
11 0.19
12 0.19
13 0.21
14 0.23
15 0.23
16 0.2
17 0.2
18 0.2
19 0.18
20 0.19
21 0.21
22 0.19
23 0.18
24 0.18
25 0.19
26 0.21
27 0.22
28 0.22
29 0.22
30 0.31
31 0.32
32 0.34
33 0.37
34 0.39
35 0.44
36 0.44
37 0.42
38 0.35
39 0.35
40 0.32
41 0.29
42 0.25
43 0.2
44 0.24
45 0.21
46 0.21
47 0.2
48 0.23
49 0.25
50 0.24
51 0.26
52 0.24
53 0.29
54 0.3
55 0.31
56 0.32
57 0.32
58 0.33
59 0.3
60 0.32
61 0.29
62 0.3
63 0.29
64 0.26
65 0.23
66 0.21
67 0.2
68 0.15
69 0.13
70 0.13
71 0.14
72 0.14
73 0.15
74 0.19
75 0.19
76 0.24
77 0.24
78 0.24
79 0.23
80 0.23
81 0.24
82 0.2
83 0.21
84 0.16
85 0.19
86 0.18
87 0.18
88 0.17
89 0.16
90 0.16
91 0.15
92 0.16
93 0.13
94 0.16
95 0.18
96 0.21
97 0.28
98 0.34
99 0.34
100 0.38
101 0.46
102 0.53
103 0.59
104 0.67
105 0.71
106 0.74
107 0.81
108 0.84
109 0.85
110 0.84
111 0.83
112 0.82
113 0.82
114 0.84
115 0.85
116 0.89
117 0.88