Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3KHZ6

Protein Details
Accession J3KHZ6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNIPKTRRTYCKSKQCKKHTQHRVTQYKAGKHydrophilic
NLS Segment(s)
PositionSequence
59-63RKKAK
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cim:CIMG_00888  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKSKQCKKHTQHRVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFRKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.87
4 0.91
5 0.9
6 0.91
7 0.91
8 0.89
9 0.88
10 0.88
11 0.87
12 0.81
13 0.8
14 0.75
15 0.69
16 0.62
17 0.54
18 0.43
19 0.35
20 0.32
21 0.33
22 0.31
23 0.27
24 0.33
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.42
41 0.36
42 0.38
43 0.39
44 0.4
45 0.35
46 0.43
47 0.48
48 0.56
49 0.64
50 0.67
51 0.68
52 0.71
53 0.78
54 0.77
55 0.74
56 0.71
57 0.65
58 0.62
59 0.59
60 0.52
61 0.48
62 0.45
63 0.39
64 0.33
65 0.31
66 0.3
67 0.34
68 0.4
69 0.42
70 0.46
71 0.56
72 0.62
73 0.67
74 0.65
75 0.59
76 0.55
77 0.5
78 0.49
79 0.49
80 0.5
81 0.51
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42