FuNGI

W9WHH0

Protein Details

Accession

W9WHH0

Localization Confidence

Medium

Confidence Score

12.1

NoLS Segment(s)

Position	Sequence	Protein Nature
89-118	LDRPFPPGEKKRAMKKQQRRPSRPGEPYAR	Basic

NLS Segment(s)

Position	Sequence
95-112	PGEKKRAMKKQQRRPSRP

Subcellular Location(s)

nucl 14, cyto_nucl 10.5, mito 5, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR018608 Gti1/Pac2
Pfam	View protein in Pfam PF09729 Gti1_Pac2

Amino Acid Sequences

MSSGGAALQPTFQGHVSTTQDALILFEACLQGHLSHVPRRPHDRERSSLIRSGCVFIYEENASGIKRWTDGVTWSPSRILGNFLVYRELDRPFPPGEKKRAMKKQQRRPSRPGEPYARSETGSYTDGQSNGYSQERTTSAEVERQLIGSLVDSYGFKQDGLVKKTMSVTVQGVTHHLVSYYHVNDVLNTQLRRPSETESLTYVRPRLELTQKQSFRAPLEEQNEVDATQSAYGYRVNGAAYPQTSFYMPQSYPSVPHQPSQSPYPIGVPAISTAYMHPSITAPHLQGPRNDYGPYEQAGYNRSYESLNGAMTPTSKSIPPTPTTMAPMISDRAQPQAPMYPPMSMQRPVNSLTSVSVDTHNTVPYRPSPYPVHHPTPAQIDQSRQSQHSPVQVKYEDRRDQAPPQSQMYQSTRTGYYGEAASQVMHQPQYSQQPPIPQWVGQGHSA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.19
3	0.23
4	0.24
5	0.24
6	0.22
7	0.22
8	0.21
9	0.21
10	0.16
11	0.12
12	0.1
13	0.11
14	0.12
15	0.11
16	0.12
17	0.12
18	0.1
19	0.11
20	0.17
21	0.19
22	0.26
23	0.33
24	0.4
25	0.46
26	0.55
27	0.62
28	0.67
29	0.73
30	0.73
31	0.73
32	0.74
33	0.74
34	0.69
35	0.67
36	0.58
37	0.52
38	0.46
39	0.42
40	0.34
41	0.28
42	0.24
43	0.19
44	0.22
45	0.17
46	0.16
47	0.15
48	0.15
49	0.14
50	0.14
51	0.16
52	0.13
53	0.12
54	0.14
55	0.14
56	0.15
57	0.18
58	0.22
59	0.27
60	0.28
61	0.29
62	0.28
63	0.28
64	0.28
65	0.25
66	0.23
67	0.17
68	0.21
69	0.22
70	0.22
71	0.23
72	0.22
73	0.24
74	0.23
75	0.23
76	0.2
77	0.19
78	0.22
79	0.22
80	0.27
81	0.34
82	0.4
83	0.46
84	0.53
85	0.59
86	0.66
87	0.74
88	0.78
89	0.8
90	0.83
91	0.86
92	0.87
93	0.91
94	0.89
95	0.87
96	0.87
97	0.86
98	0.83
99	0.81
100	0.79
101	0.73
102	0.7
103	0.68
104	0.6
105	0.5
106	0.43
107	0.36
108	0.3
109	0.26
110	0.21
111	0.17
112	0.17
113	0.17
114	0.17
115	0.16
116	0.14
117	0.15
118	0.16
119	0.14
120	0.12
121	0.15
122	0.15
123	0.17
124	0.18
125	0.18
126	0.17
127	0.21
128	0.22
129	0.21
130	0.2
131	0.17
132	0.16
133	0.14
134	0.12
135	0.08
136	0.08
137	0.06
138	0.06
139	0.06
140	0.07
141	0.09
142	0.09
143	0.08
144	0.09
145	0.15
146	0.21
147	0.25
148	0.27
149	0.24
150	0.26
151	0.27
152	0.27
153	0.22
154	0.17
155	0.14
156	0.14
157	0.15
158	0.13
159	0.14
160	0.13
161	0.13
162	0.11
163	0.1
164	0.08
165	0.09
166	0.13
167	0.13
168	0.12
169	0.12
170	0.12
171	0.12
172	0.13
173	0.15
174	0.16
175	0.15
176	0.16
177	0.18
178	0.19
179	0.21
180	0.22
181	0.23
182	0.23
183	0.24
184	0.25
185	0.25
186	0.26
187	0.25
188	0.25
189	0.22
190	0.17
191	0.16
192	0.15
193	0.16
194	0.23
195	0.27
196	0.32
197	0.4
198	0.4
199	0.41
200	0.42
201	0.4
202	0.33
203	0.31
204	0.27
205	0.24
206	0.26
207	0.26
208	0.24
209	0.23
210	0.22
211	0.18
212	0.16
213	0.1
214	0.07
215	0.06
216	0.06
217	0.05
218	0.05
219	0.06
220	0.06
221	0.06
222	0.06
223	0.06
224	0.07
225	0.07
226	0.08
227	0.08
228	0.09
229	0.09
230	0.09
231	0.09
232	0.09
233	0.1
234	0.13
235	0.12
236	0.14
237	0.17
238	0.16
239	0.18
240	0.21
241	0.28
242	0.25
243	0.27
244	0.28
245	0.27
246	0.29
247	0.31
248	0.31
249	0.23
250	0.23
251	0.22
252	0.2
253	0.17
254	0.15
255	0.11
256	0.09
257	0.09
258	0.08
259	0.07
260	0.07
261	0.09
262	0.1
263	0.09
264	0.09
265	0.09
266	0.1
267	0.12
268	0.14
269	0.11
270	0.16
271	0.21
272	0.23
273	0.25
274	0.29
275	0.29
276	0.29
277	0.28
278	0.23
279	0.22
280	0.22
281	0.2
282	0.18
283	0.17
284	0.17
285	0.19
286	0.19
287	0.17
288	0.16
289	0.16
290	0.13
291	0.12
292	0.14
293	0.13
294	0.12
295	0.11
296	0.11
297	0.1
298	0.11
299	0.12
300	0.1
301	0.1
302	0.11
303	0.13
304	0.19
305	0.23
306	0.24
307	0.27
308	0.28
309	0.29
310	0.32
311	0.3
312	0.25
313	0.22
314	0.22
315	0.2
316	0.18
317	0.19
318	0.16
319	0.19
320	0.18
321	0.18
322	0.18
323	0.22
324	0.21
325	0.23
326	0.23
327	0.21
328	0.22
329	0.26
330	0.28
331	0.25
332	0.26
333	0.25
334	0.27
335	0.28
336	0.28
337	0.25
338	0.22
339	0.2
340	0.2
341	0.18
342	0.17
343	0.17
344	0.16
345	0.17
346	0.18
347	0.2
348	0.18
349	0.17
350	0.19
351	0.22
352	0.28
353	0.27
354	0.31
355	0.33
356	0.39
357	0.48
358	0.52
359	0.54
360	0.5
361	0.51
362	0.49
363	0.51
364	0.49
365	0.45
366	0.4
367	0.38
368	0.39
369	0.44
370	0.45
371	0.39
372	0.38
373	0.37
374	0.39
375	0.44
376	0.44
377	0.39
378	0.43
379	0.44
380	0.48
381	0.51
382	0.57
383	0.55
384	0.52
385	0.55
386	0.53
387	0.57
388	0.6
389	0.61
390	0.56
391	0.54
392	0.56
393	0.53
394	0.56
395	0.53
396	0.49
397	0.42
398	0.42
399	0.37
400	0.34
401	0.33
402	0.26
403	0.24
404	0.2
405	0.18
406	0.16
407	0.15
408	0.14
409	0.15
410	0.17
411	0.18
412	0.18
413	0.17
414	0.18
415	0.23
416	0.33
417	0.34
418	0.37
419	0.36
420	0.43
421	0.45
422	0.52
423	0.5
424	0.4
425	0.43
426	0.43

W9WHH0

3D AlphaFold-predicted Structure Viewer