FuNGI

W9WBG6

Protein Details

Accession

W9WBG6

Localization Confidence

High

Confidence Score

18.4

NoLS Segment(s)

Position	Sequence	Protein Nature
24-47	KEKDNFAKRKARDSRSRSPPTRSA	Hydrophilic
115-140	LSATTIPIRRKPKQRPSQRLPNVDYV	Hydrophilic
377-403	ISKAENKPKLKIKRKYQTQRTPSPTNE	Hydrophilic
514-536	VDEGGKTGRKRSRQSGEQRWATW	Hydrophilic

NLS Segment(s)

Position	Sequence
384-389	PKLKIK

Subcellular Location(s)

nucl 20, cyto_nucl 13, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR034443 PB1A10.08

Amino Acid Sequences

MMVPRSFSHNPLAQRQQQIEFTEKEKDNFAKRKARDSRSRSPPTRSALSQSLSQERAAALHRPTSDPVKIPSKTEPRIQLTPRRPGPSSLQPSTSSPVLRSQPVPRRKQSAQDVLSATTIPIRRKPKQRPSQRLPNVDYVADFSKLLRDDVQSSHEGSLSGSWTNPQFEGLFGTIDGLVEGQMIVGSEGLDAGILSARSLSAESMPSLSSADDFSSISPATVRSPSDHRLRQMASSEDCSNEHPLLPMDEEDHFSETSTPELTISPPSQLRRRPMPLKKTQSSFKSSLTASLRALKSAAQTVSNIATTPPLVQPDDFLATSVFEFRPSLTDDRRPPPSDEPPSAAVRRYLNPHTVVPADSPAQLHFWVDEKPTPTQISKAENKPKLKIKRKYQTQRTPSPTNERAPFSAYASTTSQLPSLVPLATCIPSTIRTAHASSPPTWLEPDGTPSNKFRAAQTLWADPEHGIDQGQPRPREPRENRDFLRVFVCEMNMRKNGKLADDAPGRAKLWLPAVDEGGKTGRKRSRQSGEQRWATWSVDDS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.61
3	0.59
4	0.58
5	0.57
6	0.53
7	0.47
8	0.43
9	0.45
10	0.43
11	0.4
12	0.41
13	0.44
14	0.48
15	0.54
16	0.6
17	0.6
18	0.61
19	0.7
20	0.74
21	0.78
22	0.78
23	0.78
24	0.8
25	0.81
26	0.89
27	0.84
28	0.82
29	0.8
30	0.76
31	0.74
32	0.66
33	0.61
34	0.57
35	0.53
36	0.5
37	0.47
38	0.47
39	0.42
40	0.39
41	0.34
42	0.27
43	0.27
44	0.25
45	0.25
46	0.21
47	0.25
48	0.26
49	0.28
50	0.31
51	0.35
52	0.36
53	0.34
54	0.38
55	0.41
56	0.41
57	0.41
58	0.48
59	0.51
60	0.52
61	0.56
62	0.58
63	0.56
64	0.63
65	0.66
66	0.67
67	0.66
68	0.72
69	0.72
70	0.68
71	0.63
72	0.59
73	0.6
74	0.6
75	0.61
76	0.54
77	0.5
78	0.47
79	0.48
80	0.48
81	0.43
82	0.34
83	0.27
84	0.3
85	0.3
86	0.31
87	0.33
88	0.39
89	0.45
90	0.54
91	0.61
92	0.6
93	0.65
94	0.64
95	0.69
96	0.69
97	0.7
98	0.62
99	0.6
100	0.55
101	0.48
102	0.46
103	0.37
104	0.27
105	0.22
106	0.23
107	0.2
108	0.26
109	0.33
110	0.41
111	0.51
112	0.62
113	0.68
114	0.75
115	0.84
116	0.87
117	0.88
118	0.91
119	0.9
120	0.88
121	0.81
122	0.78
123	0.69
124	0.58
125	0.49
126	0.41
127	0.34
128	0.26
129	0.21
130	0.13
131	0.15
132	0.15
133	0.16
134	0.15
135	0.15
136	0.17
137	0.18
138	0.22
139	0.19
140	0.21
141	0.2
142	0.19
143	0.17
144	0.14
145	0.14
146	0.12
147	0.11
148	0.09
149	0.1
150	0.11
151	0.12
152	0.12
153	0.12
154	0.11
155	0.11
156	0.13
157	0.12
158	0.11
159	0.09
160	0.1
161	0.08
162	0.08
163	0.07
164	0.05
165	0.04
166	0.04
167	0.04
168	0.03
169	0.03
170	0.03
171	0.03
172	0.03
173	0.03
174	0.03
175	0.03
176	0.03
177	0.03
178	0.03
179	0.03
180	0.04
181	0.03
182	0.03
183	0.04
184	0.04
185	0.04
186	0.05
187	0.05
188	0.05
189	0.06
190	0.06
191	0.07
192	0.08
193	0.08
194	0.08
195	0.07
196	0.07
197	0.07
198	0.07
199	0.07
200	0.07
201	0.07
202	0.08
203	0.08
204	0.07
205	0.07
206	0.08
207	0.09
208	0.1
209	0.11
210	0.12
211	0.16
212	0.21
213	0.29
214	0.31
215	0.31
216	0.34
217	0.34
218	0.34
219	0.32
220	0.31
221	0.25
222	0.25
223	0.24
224	0.21
225	0.2
226	0.2
227	0.2
228	0.17
229	0.15
230	0.12
231	0.11
232	0.11
233	0.11
234	0.1
235	0.09
236	0.09
237	0.1
238	0.1
239	0.11
240	0.1
241	0.1
242	0.11
243	0.09
244	0.09
245	0.08
246	0.07
247	0.06
248	0.07
249	0.07
250	0.09
251	0.09
252	0.11
253	0.13
254	0.16
255	0.21
256	0.25
257	0.29
258	0.33
259	0.39
260	0.47
261	0.52
262	0.58
263	0.63
264	0.68
265	0.68
266	0.66
267	0.65
268	0.6
269	0.58
270	0.52
271	0.43
272	0.38
273	0.33
274	0.35
275	0.31
276	0.29
277	0.23
278	0.27
279	0.26
280	0.23
281	0.23
282	0.18
283	0.16
284	0.18
285	0.17
286	0.11
287	0.11
288	0.12
289	0.13
290	0.12
291	0.11
292	0.08
293	0.08
294	0.07
295	0.09
296	0.08
297	0.09
298	0.1
299	0.1
300	0.1
301	0.11
302	0.13
303	0.12
304	0.11
305	0.09
306	0.09
307	0.09
308	0.11
309	0.09
310	0.08
311	0.08
312	0.08
313	0.1
314	0.12
315	0.16
316	0.17
317	0.24
318	0.3
319	0.34
320	0.41
321	0.42
322	0.42
323	0.45
324	0.5
325	0.5
326	0.46
327	0.44
328	0.41
329	0.43
330	0.4
331	0.35
332	0.29
333	0.26
334	0.26
335	0.28
336	0.28
337	0.28
338	0.29
339	0.29
340	0.28
341	0.26
342	0.24
343	0.2
344	0.19
345	0.16
346	0.14
347	0.14
348	0.12
349	0.13
350	0.12
351	0.11
352	0.1
353	0.1
354	0.11
355	0.13
356	0.15
357	0.16
358	0.18
359	0.21
360	0.23
361	0.22
362	0.24
363	0.25
364	0.3
365	0.35
366	0.43
367	0.49
368	0.55
369	0.58
370	0.61
371	0.67
372	0.7
373	0.73
374	0.74
375	0.75
376	0.78
377	0.85
378	0.89
379	0.91
380	0.91
381	0.89
382	0.89
383	0.86
384	0.82
385	0.77
386	0.76
387	0.71
388	0.67
389	0.63
390	0.56
391	0.5
392	0.47
393	0.42
394	0.35
395	0.33
396	0.26
397	0.24
398	0.22
399	0.22
400	0.19
401	0.18
402	0.16
403	0.13
404	0.12
405	0.11
406	0.11
407	0.11
408	0.1
409	0.1
410	0.12
411	0.13
412	0.13
413	0.12
414	0.12
415	0.13
416	0.15
417	0.16
418	0.17
419	0.19
420	0.21
421	0.25
422	0.29
423	0.31
424	0.3
425	0.33
426	0.31
427	0.29
428	0.28
429	0.25
430	0.22
431	0.2
432	0.25
433	0.26
434	0.28
435	0.29
436	0.31
437	0.34
438	0.35
439	0.35
440	0.3
441	0.32
442	0.32
443	0.36
444	0.38
445	0.39
446	0.37
447	0.37
448	0.36
449	0.28
450	0.28
451	0.21
452	0.18
453	0.12
454	0.14
455	0.19
456	0.24
457	0.32
458	0.31
459	0.34
460	0.42
461	0.47
462	0.56
463	0.58
464	0.62
465	0.64
466	0.72
467	0.71
468	0.73
469	0.69
470	0.59
471	0.57
472	0.47
473	0.4
474	0.32
475	0.32
476	0.27
477	0.29
478	0.34
479	0.36
480	0.38
481	0.36
482	0.4
483	0.39
484	0.37
485	0.39
486	0.34
487	0.36
488	0.38
489	0.4
490	0.39
491	0.4
492	0.37
493	0.33
494	0.32
495	0.26
496	0.27
497	0.29
498	0.28
499	0.27
500	0.3
501	0.31
502	0.3
503	0.29
504	0.29
505	0.3
506	0.28
507	0.34
508	0.39
509	0.45
510	0.53
511	0.61
512	0.66
513	0.71
514	0.81
515	0.83
516	0.86
517	0.84
518	0.78
519	0.72
520	0.65
521	0.57

W9WBG6

3D AlphaFold-predicted Structure Viewer