Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9W5R3

Protein Details
Accession W9W5R3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
311-336DQHHGPALPKPRKNRRGQRARQQIAEHydrophilic
NLS Segment(s)
PositionSequence
319-331PKPRKNRRGQRAR
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR037393  Bud22/SRFB1  
IPR015158  Bud22_dom  
Pfam View protein in Pfam  
PF09073  BUD22  
Amino Acid Sequences MLKRKREDSAGSLDSEDENLKLKVSRLKAKTGQGVKALHDALKLARGFERQKLGRRQKSASDAPQTLLRLREEVIVLKQLQLDKTAKSRLFKNLFKTKRIREHPVFIKAYGVEPVLDNVKAGAEANVVGRLFNSNPVKQALPVIMKSIYAVLGIPQVTPPKPVGTGNPASKAAKEKAEPKLDSDFDGFSGSDMEDHAVLGEEQGLGSDETDEEMLGYAGRLASSSEDSEEDSIGIPSLSPQRTGVQSHDVGGLAGRESLSLSPTPSEVSEPDDARRPPASHLRHKTSTTAFLPSLSMGGYYSGSDSEDDGDQHHGPALPKPRKNRRGQRARQQIAELKYGENAKHLGKQKPQDARSAGWDARRGAVGQHDSPKDRLWKRMAPQKRTEGRSTTRIGRTLNSDKQKSRDDQGPIHPSWEAARRRKMQDQAQASFQGKKITFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.23
4 0.15
5 0.16
6 0.14
7 0.15
8 0.16
9 0.19
10 0.25
11 0.32
12 0.41
13 0.42
14 0.51
15 0.56
16 0.62
17 0.67
18 0.67
19 0.64
20 0.61
21 0.6
22 0.53
23 0.52
24 0.46
25 0.38
26 0.32
27 0.28
28 0.23
29 0.27
30 0.24
31 0.2
32 0.22
33 0.27
34 0.3
35 0.35
36 0.43
37 0.43
38 0.52
39 0.61
40 0.69
41 0.71
42 0.74
43 0.73
44 0.71
45 0.73
46 0.73
47 0.7
48 0.67
49 0.6
50 0.55
51 0.55
52 0.49
53 0.43
54 0.38
55 0.31
56 0.24
57 0.23
58 0.24
59 0.21
60 0.21
61 0.21
62 0.22
63 0.22
64 0.22
65 0.23
66 0.23
67 0.23
68 0.25
69 0.25
70 0.23
71 0.29
72 0.35
73 0.36
74 0.37
75 0.41
76 0.46
77 0.52
78 0.54
79 0.58
80 0.61
81 0.62
82 0.67
83 0.71
84 0.7
85 0.73
86 0.75
87 0.76
88 0.71
89 0.75
90 0.74
91 0.74
92 0.67
93 0.57
94 0.52
95 0.42
96 0.37
97 0.29
98 0.22
99 0.13
100 0.12
101 0.13
102 0.12
103 0.11
104 0.1
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.05
111 0.06
112 0.07
113 0.09
114 0.09
115 0.08
116 0.08
117 0.1
118 0.1
119 0.17
120 0.21
121 0.2
122 0.22
123 0.24
124 0.25
125 0.23
126 0.24
127 0.21
128 0.19
129 0.19
130 0.19
131 0.17
132 0.16
133 0.16
134 0.15
135 0.11
136 0.08
137 0.07
138 0.06
139 0.08
140 0.08
141 0.08
142 0.09
143 0.12
144 0.12
145 0.14
146 0.14
147 0.13
148 0.14
149 0.15
150 0.16
151 0.2
152 0.26
153 0.27
154 0.29
155 0.3
156 0.29
157 0.3
158 0.32
159 0.27
160 0.25
161 0.25
162 0.29
163 0.35
164 0.42
165 0.41
166 0.39
167 0.41
168 0.38
169 0.37
170 0.32
171 0.24
172 0.17
173 0.18
174 0.15
175 0.09
176 0.09
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.04
210 0.05
211 0.06
212 0.06
213 0.07
214 0.07
215 0.08
216 0.07
217 0.07
218 0.06
219 0.06
220 0.05
221 0.05
222 0.04
223 0.05
224 0.11
225 0.11
226 0.11
227 0.13
228 0.14
229 0.17
230 0.19
231 0.19
232 0.18
233 0.18
234 0.19
235 0.18
236 0.16
237 0.14
238 0.13
239 0.11
240 0.06
241 0.06
242 0.05
243 0.04
244 0.05
245 0.05
246 0.06
247 0.06
248 0.07
249 0.07
250 0.08
251 0.08
252 0.08
253 0.09
254 0.08
255 0.12
256 0.15
257 0.15
258 0.16
259 0.22
260 0.21
261 0.23
262 0.26
263 0.23
264 0.24
265 0.32
266 0.38
267 0.43
268 0.5
269 0.55
270 0.57
271 0.57
272 0.58
273 0.51
274 0.5
275 0.41
276 0.37
277 0.3
278 0.26
279 0.25
280 0.2
281 0.18
282 0.11
283 0.09
284 0.06
285 0.06
286 0.06
287 0.06
288 0.06
289 0.06
290 0.07
291 0.07
292 0.07
293 0.08
294 0.08
295 0.08
296 0.09
297 0.12
298 0.12
299 0.12
300 0.13
301 0.14
302 0.14
303 0.19
304 0.29
305 0.34
306 0.39
307 0.49
308 0.59
309 0.67
310 0.77
311 0.82
312 0.83
313 0.86
314 0.9
315 0.91
316 0.91
317 0.86
318 0.79
319 0.74
320 0.7
321 0.62
322 0.57
323 0.47
324 0.36
325 0.35
326 0.34
327 0.28
328 0.23
329 0.22
330 0.2
331 0.26
332 0.32
333 0.36
334 0.4
335 0.48
336 0.54
337 0.61
338 0.61
339 0.61
340 0.58
341 0.53
342 0.51
343 0.51
344 0.45
345 0.4
346 0.42
347 0.36
348 0.34
349 0.33
350 0.27
351 0.22
352 0.27
353 0.28
354 0.28
355 0.34
356 0.37
357 0.39
358 0.41
359 0.44
360 0.47
361 0.46
362 0.49
363 0.49
364 0.52
365 0.58
366 0.66
367 0.71
368 0.69
369 0.74
370 0.77
371 0.79
372 0.77
373 0.75
374 0.73
375 0.69
376 0.68
377 0.65
378 0.63
379 0.59
380 0.58
381 0.53
382 0.48
383 0.51
384 0.53
385 0.56
386 0.57
387 0.59
388 0.6
389 0.64
390 0.69
391 0.65
392 0.62
393 0.6
394 0.58
395 0.57
396 0.62
397 0.64
398 0.56
399 0.54
400 0.48
401 0.41
402 0.39
403 0.4
404 0.4
405 0.41
406 0.5
407 0.56
408 0.63
409 0.71
410 0.75
411 0.76
412 0.76
413 0.76
414 0.7
415 0.67
416 0.66
417 0.6
418 0.57
419 0.49
420 0.48