Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VSD2

Protein Details
Accession W9VSD2    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-76NGGVTKSKKKQKPLTRGQRQRQERVLHydrophilic
NLS Segment(s)
PositionSequence
56-67KSKKKQKPLTRG
96-103RLKKRRER
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKTAKVKKATANSRSRASKRATSPSIDVDKSIKQAPRASDVTPLLAARPNGGVTKSKKKQKPLTRGQRQRQERVLARAEVVQDQMSKKVEDAAGRLKKRRERKCMWDEVNGSVNKFEKLKTLGDEVDEEEKDEWEDMEEVDERADNLPGTADTHLVVVDRTAHSLAAAPTAAEDDEVDKIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.72
4 0.69
5 0.65
6 0.64
7 0.62
8 0.66
9 0.61
10 0.56
11 0.56
12 0.56
13 0.56
14 0.48
15 0.42
16 0.36
17 0.34
18 0.33
19 0.35
20 0.3
21 0.28
22 0.32
23 0.33
24 0.37
25 0.37
26 0.34
27 0.35
28 0.33
29 0.31
30 0.27
31 0.24
32 0.19
33 0.19
34 0.18
35 0.13
36 0.13
37 0.13
38 0.13
39 0.14
40 0.19
41 0.22
42 0.33
43 0.4
44 0.49
45 0.53
46 0.62
47 0.7
48 0.74
49 0.79
50 0.79
51 0.83
52 0.84
53 0.9
54 0.89
55 0.89
56 0.85
57 0.81
58 0.76
59 0.72
60 0.65
61 0.61
62 0.55
63 0.45
64 0.39
65 0.34
66 0.29
67 0.22
68 0.19
69 0.13
70 0.11
71 0.11
72 0.13
73 0.13
74 0.12
75 0.11
76 0.12
77 0.13
78 0.12
79 0.14
80 0.2
81 0.27
82 0.29
83 0.33
84 0.37
85 0.43
86 0.52
87 0.6
88 0.6
89 0.6
90 0.68
91 0.72
92 0.77
93 0.73
94 0.7
95 0.62
96 0.56
97 0.55
98 0.45
99 0.37
100 0.28
101 0.25
102 0.2
103 0.19
104 0.16
105 0.13
106 0.16
107 0.17
108 0.18
109 0.2
110 0.19
111 0.2
112 0.2
113 0.19
114 0.2
115 0.18
116 0.17
117 0.14
118 0.14
119 0.13
120 0.12
121 0.1
122 0.08
123 0.08
124 0.07
125 0.09
126 0.09
127 0.09
128 0.09
129 0.09
130 0.08
131 0.09
132 0.1
133 0.08
134 0.07
135 0.08
136 0.08
137 0.1
138 0.09
139 0.09
140 0.08
141 0.09
142 0.09
143 0.08
144 0.08
145 0.07
146 0.1
147 0.1
148 0.12
149 0.12
150 0.12
151 0.12
152 0.15
153 0.15
154 0.13
155 0.13
156 0.1
157 0.1
158 0.11
159 0.11
160 0.09
161 0.09
162 0.08