Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WDH2

Protein Details
Accession W9WDH2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-93GTGTAASPPKKRKPRAKKAAGEESNKKHydrophilic
NLS Segment(s)
PositionSequence
74-95PPKKRKPRAKKAAGEESNKKQK
Subcellular Location(s) cyto 17.5, cyto_nucl 11.833, nucl 5, mito_nucl 4.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MASSSTDDKIAFILTVFKHTTLPKPDYAAVAVETGINTASNAAIVKAAGFELVNDQIVGPGGSTGDGTGTAASPPKKRKPRAKKAAGEESNKKQKVKQEDDAEVQTNQGVEASTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.17
3 0.18
4 0.18
5 0.21
6 0.23
7 0.29
8 0.31
9 0.35
10 0.32
11 0.35
12 0.35
13 0.33
14 0.32
15 0.26
16 0.19
17 0.16
18 0.14
19 0.1
20 0.09
21 0.07
22 0.07
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.08
59 0.11
60 0.16
61 0.24
62 0.34
63 0.43
64 0.52
65 0.63
66 0.71
67 0.8
68 0.85
69 0.89
70 0.87
71 0.87
72 0.89
73 0.84
74 0.81
75 0.77
76 0.76
77 0.76
78 0.71
79 0.64
80 0.57
81 0.57
82 0.6
83 0.61
84 0.6
85 0.58
86 0.6
87 0.63
88 0.64
89 0.59
90 0.48
91 0.4
92 0.32
93 0.24
94 0.18
95 0.13