Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WP05

Protein Details
Accession W9WP05    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
118-140LTAGRCEHCKKKIRNWHGSCTGEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 10, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MSERNYKTINLPGDDSDDFEIVFKWLYGDKKIMEESVLRIATTYKTAYKYCLPDLQHALVEAIKEISATTRLTPTDAMQIYRGSPNGCKLRNVVVDRLHDDICKWPDEYGVKVDRSDLTAGRCEHCKKKIRNWHGSCTGECKSNIILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.26
4 0.21
5 0.18
6 0.16
7 0.15
8 0.1
9 0.1
10 0.08
11 0.07
12 0.11
13 0.13
14 0.15
15 0.18
16 0.19
17 0.21
18 0.23
19 0.22
20 0.19
21 0.18
22 0.18
23 0.21
24 0.21
25 0.17
26 0.16
27 0.17
28 0.16
29 0.17
30 0.17
31 0.14
32 0.17
33 0.18
34 0.21
35 0.25
36 0.27
37 0.28
38 0.32
39 0.3
40 0.32
41 0.35
42 0.33
43 0.28
44 0.25
45 0.23
46 0.17
47 0.15
48 0.11
49 0.07
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.1
61 0.1
62 0.14
63 0.14
64 0.14
65 0.13
66 0.14
67 0.14
68 0.15
69 0.15
70 0.1
71 0.11
72 0.17
73 0.23
74 0.23
75 0.23
76 0.24
77 0.29
78 0.35
79 0.37
80 0.35
81 0.33
82 0.35
83 0.36
84 0.37
85 0.31
86 0.24
87 0.23
88 0.25
89 0.22
90 0.21
91 0.19
92 0.17
93 0.2
94 0.22
95 0.23
96 0.22
97 0.25
98 0.25
99 0.24
100 0.26
101 0.22
102 0.23
103 0.23
104 0.19
105 0.17
106 0.22
107 0.24
108 0.25
109 0.3
110 0.34
111 0.4
112 0.46
113 0.53
114 0.56
115 0.65
116 0.73
117 0.78
118 0.83
119 0.82
120 0.83
121 0.82
122 0.79
123 0.7
124 0.66
125 0.58
126 0.52
127 0.46
128 0.39