Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9W290

Protein Details
Accession W9W290    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-73GYIIAQKPKKHGKRDRPYLTVHydrophilic
NLS Segment(s)
PositionSequence
61-65KKHGK
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MPDKSPTLYLIRHGEKPPKQPDGEDGPGLSQQGVDRAQAMVEVFGRNSPYNIGYIIAQKPKKHGKRDRPYLTVKPLAESLEQFGVPFDFTIERDHVDKVKDAVHDYIKGKGSGGEGNVLICWEHDTLEKIAGVLGVDKVPDYPGKRFDLIWTIEPPYEKINSYTSEHVQGLDDEYANEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.62
4 0.64
5 0.63
6 0.6
7 0.55
8 0.56
9 0.55
10 0.52
11 0.44
12 0.36
13 0.3
14 0.3
15 0.29
16 0.22
17 0.14
18 0.1
19 0.13
20 0.13
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.11
27 0.08
28 0.08
29 0.09
30 0.08
31 0.09
32 0.12
33 0.12
34 0.12
35 0.12
36 0.12
37 0.12
38 0.12
39 0.12
40 0.1
41 0.14
42 0.18
43 0.24
44 0.26
45 0.26
46 0.33
47 0.43
48 0.5
49 0.56
50 0.62
51 0.66
52 0.74
53 0.84
54 0.84
55 0.8
56 0.79
57 0.74
58 0.7
59 0.65
60 0.54
61 0.44
62 0.38
63 0.33
64 0.27
65 0.21
66 0.17
67 0.12
68 0.11
69 0.1
70 0.09
71 0.07
72 0.07
73 0.06
74 0.05
75 0.05
76 0.05
77 0.08
78 0.08
79 0.09
80 0.1
81 0.11
82 0.12
83 0.13
84 0.13
85 0.12
86 0.15
87 0.15
88 0.15
89 0.17
90 0.17
91 0.2
92 0.2
93 0.24
94 0.22
95 0.21
96 0.2
97 0.18
98 0.18
99 0.16
100 0.15
101 0.12
102 0.11
103 0.11
104 0.1
105 0.09
106 0.07
107 0.06
108 0.07
109 0.06
110 0.07
111 0.07
112 0.1
113 0.11
114 0.13
115 0.12
116 0.11
117 0.1
118 0.1
119 0.09
120 0.07
121 0.07
122 0.06
123 0.06
124 0.06
125 0.06
126 0.08
127 0.12
128 0.15
129 0.18
130 0.22
131 0.27
132 0.28
133 0.28
134 0.3
135 0.32
136 0.32
137 0.32
138 0.3
139 0.28
140 0.29
141 0.3
142 0.28
143 0.25
144 0.24
145 0.21
146 0.21
147 0.22
148 0.24
149 0.27
150 0.3
151 0.3
152 0.33
153 0.32
154 0.3
155 0.28
156 0.25
157 0.24
158 0.21
159 0.19